Rv3505 - acyl-CoA dehydrogenase fadE27

Expression: Most Significant Conditions for Rv3505

Protein Domains

Gene Information
Locus	Rv3505
Symbol	fadE27
Gene Name	acyl-CoA dehydrogenase fadE27
Location	3923698 - 3924819 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1122 bp Protein:374 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20815
Related Genes	MAP0558c MAV_0651 Mkms_4711 Mmcs_4623 MSMEG_5907 MT3609 MUL_4068 Mvan_5207 nfa5310 SAV4349
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3505
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3505 Transcript 1
MDFTTTEAAQDLGGLVDTIVDAVCTPEHQRELDKLEQRFDRELWRKLIDAGILSSAAPES
LGGDGFGVLEQVAVLVALGHQLAAVPYLESVVLAAGALARFGSPELQQGWGVSAVSGDRI
LTVALDGEMGEGPVQAAGTGHGYRLTGTRTQVGYGPVADAFLVPAETDSGAAVFLVAAGD
PGVAVTALATTGLGSVGHLELNGAKVDAARRVGGTDVAVWLGTLSTLSRTAFQLGVLERG
LQMTAEYARTREQFDRPIGSFQAVGQRLADGYIDVKGLRLTLTQAAWRVAEDSLASRECP
QPADIDVATAGFWAAEAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAKQTEFALGGATGQ
LRRIGRELAETPA*

Genomic Sequence

>Rv3505
ATGGATTTCACGACAACCGAAGCCGCCCAGGATCTTGGTGGTCTGGTCGACACCATCGTG
GACGCGGTGTGCACGCCGGAGCATCAACGTGAGCTGGACAAGCTCGAGCAGCGGTTCGAC
CGCGAGCTGTGGCGCAAGCTGATAGACGCCGGCATCCTGTCCAGTGCGGCGCCGGAGTCG
CTGGGCGGCGATGGCTTCGGCGTGCTCGAGCAGGTTGCGGTGCTGGTGGCGTTGGGGCAT
CAACTGGCCGCGGTGCCGTACCTGGAGTCGGTGGTGCTCGCCGCCGGCGCCCTGGCCCGG
TTCGGCTCGCCGGAACTGCAGCAGGGCTGGGGGGTGTCGGCGGTCTCCGGCGATCGGATC
CTCACCGTCGCCCTCGACGGTGAGATGGGCGAGGGTCCGGTGCAGGCCGCCGGCACCGGA
CATGGCTACCGCCTCACCGGCACACGCACCCAGGTCGGGTACGGCCCGGTGGCCGACGCA
TTTCTGGTACCCGCCGAAACCGATTCCGGTGCAGCCGTTTTCCTGGTTGCCGCCGGCGAC
CCAGGGGTTGCGGTGACCGCACTGGCCACCACCGGACTGGGCAGCGTCGGACACCTCGAG
CTAAACGGGGCCAAAGTGGACGCCGCCCGCAGGGTCGGCGGAACCGATGTCGCGGTTTGG
CTCGGCACGCTTTCCACCCTGAGCCGCACCGCTTTTCAGCTCGGTGTGCTCGAGCGCGGA
CTGCAAATGACGGCCGAATATGCGCGCACCCGTGAACAATTCGACCGCCCGATCGGCAGC
TTCCAGGCGGTGGGGCAACGGTTGGCTGACGGCTACATCGACGTCAAGGGATTGCGACTG
ACGCTTACCCAGGCGGCCTGGCGGGTGGCCGAAGATTCCCTGGCAAGCCGGGAGTGCCCC
CAGCCAGCCGACATCGACGTCGCCACCGCGGGGTTCTGGGCCGCCGAAGCCGGGCATCGG
GTGGCGCATACCATCGTGCATGTGCATGGCGGCGTCGGCGTCGACACCGATCATCCCGTA
CACCGGTATTTCCTGGCCGCCAAGCAGACCGAGTTCGCGTTGGGCGGCGCCACCGGTCAG
CTCCGCCGAATCGGCCGTGAACTGGCGGAAACCCCTGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3416	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv1359	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0445c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3133c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Other	product:not yet determined	active	rslayden	2012-03-05
Term	EC:1.3.99.- Oxidoreductases. Acting on the CH-CH group of donors. With other acceptors. - NR	active	rslayden	2012-03-05
Symbol	FadE27	active	rslayden	2012-03-05