Rv3538 - dehydrogenase

Expression: Most Significant Conditions for Rv3538

Protein Domains

Gene Information
Locus	Rv3538
Symbol
Gene Name	dehydrogenase
Location	3977062 - 3977922 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:861 bp Protein:287 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22835
Related Genes	MAP0529c MAV_0623 Mkms_4751 Mmcs_4663 MSMEG_5943 MT3642 MUL_4099 Mvan_5238 nfa4620
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3538
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3538 Transcript 1
MPIDLDVALGAQLPPVEFSWTSTDVQLYQLGLGAGSDPMNPRELSYLADDTPQVLPTFGN
VAATFHLTTPPTVQFPGIDIELSKVLHASERVEVPAPLPPSGSARAVTRFTDIWDKGKAA
VICSETTATTPDGLLLWTQKRSIYARGEGGFGGKRGPSGSDVAPERAPDLQVAMPILPQQ
ALLYRLCGDRNPLHSDPEFAAAAGFPRPILHGLCTYGMTCKAIVDALLDSDATAVAGYGA
RFAGVAYPGETLTVNVWKDGRRLVASVVAPTRDNAVVLSGVELVPA*

Genomic Sequence

>Rv3538
ATGCCCATCGACTTGGACGTCGCGCTGGGTGCACAGCTACCGCCCGTCGAATTCTCTTGG
ACCAGTACCGATGTGCAGCTCTACCAGCTGGGACTGGGCGCCGGCTCTGATCCGATGAAC
CCCCGTGAGCTGAGTTATCTGGCGGACGATACACCGCAGGTGTTGCCGACGTTCGGCAAC
GTCGCGGCCACCTTCCACCTCACCACACCACCGACCGTCCAGTTTCCGGGCATCGATATC
GAGCTCAGCAAGGTGCTGCACGCCAGCGAGCGAGTCGAGGTTCCCGCCCCGCTGCCGCCG
TCGGGTTCGGCCAGGGCGGTCACCCGGTTCACCGACATCTGGGACAAGGGCAAAGCCGCG
GTAATCTGCAGCGAAACGACGGCGACCACACCGGACGGCTTGCTGCTGTGGACGCAGAAG
CGGTCGATCTATGCCCGTGGCGAAGGCGGATTCGGCGGCAAGCGCGGGCCGTCGGGATCA
GATGTCGCGCCGGAGCGGGCGCCCGATCTGCAGGTCGCGATGCCGATTCTGCCGCAGCAA
GCGCTGCTCTACCGGCTCTGCGGCGACCGCAACCCGCTGCACTCGGATCCCGAATTCGCC
GCTGCCGCAGGCTTTCCCCGGCCTATTCTGCATGGCCTGTGCACCTATGGGATGACCTGC
AAGGCGATCGTCGATGCATTGCTGGACTCCGATGCGACGGCCGTGGCCGGCTACGGCGCA
CGCTTTGCTGGCGTGGCGTACCCGGGCGAGACGCTCACGGTCAACGTGTGGAAGGACGGC
CGCCGCCTGGTGGCCAGTGTCGTCGCACCCACTCGTGACAACGCTGTGGTGCTCAGCGGA
GTGGAGCTGGTGCCGGCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007