Rv3572 - hypothetical protein

Expression: Most Significant Conditions for Rv3572

Protein Domains

Gene Information
Locus	Rv3572
Symbol
Gene Name	hypothetical protein
Location	4013511 - 4014041 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:531 bp Protein:177 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6761
Related Genes	MAP0495c MAV_0589 Mkms_4797 Mmcs_4711 MSMEG_6040 MT3677 MUL_4143 Mvan_5310
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3572
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3572 Transcript 1
MTRLIPGCTLVGLMLTLLPAPTSAAGSNTATTLFPVDEVTQLETHTFLDCHPNGSCDFVA
GANLRTPDGPTGFPPGLWARQTTEIRSTNRLAYLDAHATSQFERVMKAGGSDVITTVYFG
EGPPDKYQTTGVIDSTNWSTGQPMTDVNVIVCTHMQVVYPGVNLTSPSTCAQANFS*

Genomic Sequence

>Rv3572
ATGACGCGGCTGATACCGGGTTGCACGCTCGTCGGGCTGATGCTGACGTTACTGCCCGCG
CCCACCTCGGCGGCCGGGAGCAACACCGCCACCACCCTGTTCCCGGTCGACGAGGTCACC
CAGCTGGAGACGCACACCTTCCTCGATTGCCACCCCAACGGCAGCTGCGACTTCGTCGCT
GGAGCAAATCTGCGCACACCCGACGGCCCGACGGGCTTTCCGCCCGGGCTGTGGGCGCGC
CAAACCACCGAGATCCGTTCGACGAACCGGTTGGCCTATCTGGACGCGCACGCCACCAGC
CAGTTCGAACGGGTAATGAAGGCGGGCGGATCCGACGTGATCACCACCGTCTACTTCGGC
GAGGGTCCGCCGGACAAATACCAGACCACCGGGGTCATCGACTCGACCAATTGGTCGACC
GGTCAACCGATGACCGACGTCAACGTCATCGTGTGTACACACATGCAGGTGGTCTACCCG
GGGGTCAACCTCACCTCGCCCAGCACCTGCGCGCAAGCCAACTTTTCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003