Rv3614c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3614c

Protein Domains

Gene Information
Locus	Rv3614c
Symbol
Gene Name	conserved hypothetical protein
Location	4054142 - 4054696 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:555 bp Protein:185 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11696
Related Genes	ML0407 MT3716
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3614c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3614c Transcript 1
MDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQ
EIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQ
YAFILDRMSQQVDADEHRVALLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDE
SDPW*

Genomic Sequence

>Rv3614c
GTGGACTTGCCCGGAAATGACTTTGACAGCAACGATTTCGACGCCGTGGATCTCTGGGGT
GCCGACGGCGCGGAGGGCTGGACTGCGGATCCGATTATTGGCGTCGGGTCGGCGGCGACC
CCGGACACCGGACCCGACCTGGACAATGCCCACGGTCAGGCGGAGACGGACACCGAACAA
GAGATCGCGCTTTTTACCGTGACGAATCCCCCACGCACGGTGTCGGTATCGACGCTGATG
GACGGCCGGATTGACCATGTCGAGCTGTCGGCCAGGGTGGCCTGGATGAGTGAGTCGCAG
CTCGCTTCTGAGATCCTGGTGATTGCCGACCTGGCGCGGCAGAAGGCGCAGTCGGCCCAG
TACGCCTTCATCCTTGACAGGATGAGTCAACAGGTCGATGCAGATGAACACCGCGTCGCA
CTGCTACGTAAGACCGTGGGCGAAACCTGGGGGTTACCATCGCCGGAAGAAGCCGCGGCA
GCAGAAGCTGAGGTGTTCGCGACGCGCTACAGCGACGATTGTCCAGCACCAGACGACGAG
AGCGATCCATGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3882c	active	shahanup86	2012-10-05
	Yeast two-hybrid (Physical interaction) JA. MacGurn, S. Raghavan et al. A non-RD1 gene cluster is required for Snm secretion in Mycobacterium tuberculosis. Mol. Microbiol. 2005
Interaction	Transcription Rv3849	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009
Interaction	Transcription Rv3849	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3616c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3616c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3616c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3849	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3616c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3849	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008