Rv3616c - conserved alanine and glycine rich protein

Expression: Most Significant Conditions for Rv3616c

Protein Domains

Gene Information
Locus	Rv3616c
Symbol
Gene Name	conserved alanine and glycine rich protein
Location	4055197 - 4056375 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1179 bp Protein:393 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11669
Related Genes	ML0405 MT3718
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3616c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3616c Transcript 1
MSRAFIIDPTISAIDGLYDLLGIGIPNQGGILYSSLEYFEKALEELAAAFPGDGWLGSAA
DKYAGKNRNHVNFFQELADLDRQLISLIHDQANAVQTTRDILEGAKKGLEFVRPVAVDLT
YIPVVGHALSAAFQAPFCAGAMAVVGGALAYLVVKTLINATQLLKLLAKLAELVAAAIAD
IISDVADIIKGTLGEVWEFITNALNGLKELWDKLTGWVTGLFSRGWSNLESFFAGVPGLT
GATSGLSQVTGLFGAAGLSASSGLAHADSLASSASLPALAGIGGGSGFGGLPSLAQVHAA
STRQALRPRADGPVGAAAEQVGGQSQLVSAQGSQGMGGPVGMGGMHPSSGASKGTTTKKY
SEGAAAGTEDAERAPVEADAGGGQKVLVRNVV*

Genomic Sequence

>Rv3616c
ATGAGCAGAGCGTTCATCATCGATCCAACGATCAGTGCCATTGACGGCTTGTACGACCTT
CTGGGGATTGGAATACCCAACCAAGGGGGTATCCTTTACTCCTCACTAGAGTACTTCGAA
AAAGCCCTGGAGGAGCTGGCAGCAGCGTTTCCGGGTGATGGCTGGTTAGGTTCGGCCGCG
GACAAATACGCCGGCAAAAACCGCAACCACGTGAATTTTTTCCAGGAACTGGCAGACCTC
GATCGTCAGCTCATCAGCCTGATCCACGACCAGGCCAACGCGGTCCAGACGACCCGCGAC
ATCCTGGAGGGCGCCAAGAAAGGTCTCGAGTTCGTGCGCCCGGTGGCTGTGGACCTGACC
TACATCCCGGTCGTCGGGCACGCCCTATCGGCCGCCTTCCAGGCGCCGTTTTGCGCGGGC
GCGATGGCCGTAGTGGGCGGCGCGCTTGCCTACTTGGTCGTGAAAACGCTGATCAACGCG
ACTCAACTCCTCAAATTGCTTGCCAAATTGGCGGAGTTGGTCGCGGCCGCCATTGCGGAC
ATCATTTCGGATGTGGCGGACATCATCAAGGGCACCCTCGGAGAAGTGTGGGAGTTCATC
ACAAACGCGCTCAACGGCCTGAAAGAGCTTTGGGACAAGCTCACGGGGTGGGTGACCGGA
CTGTTCTCTCGAGGGTGGTCGAACCTGGAGTCCTTCTTTGCGGGCGTCCCCGGCTTGACC
GGCGCGACCAGCGGCTTGTCGCAAGTGACTGGCTTGTTCGGTGCGGCCGGTCTGTCCGCA
TCGTCGGGCTTGGCTCACGCGGATAGCCTGGCGAGCTCAGCCAGCTTGCCCGCCCTGGCC
GGCATTGGGGGCGGGTCCGGTTTTGGGGGCTTGCCGAGCCTGGCTCAGGTCCATGCCGCC
TCAACTCGGCAGGCGCTACGGCCCCGAGCTGATGGCCCGGTCGGCGCCGCTGCCGAGCAG
GTCGGCGGGCAGTCGCAGCTGGTCTCCGCGCAGGGTTCCCAAGGTATGGGCGGACCCGTA
GGCATGGGCGGCATGCACCCCTCTTCGGGGGCGTCGAAAGGGACGACGACGAAGAAGTAC
TCGGAAGGCGCGGCGGCGGGCACTGAAGACGCCGAGCGCGCGCCAGTCGAAGCTGACGCG
GGCGGTGGGCAAAAGGTGCTGGTACGAAACGTCGTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3849	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009
Interaction	Transcription Rv3849	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3849	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3614c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3615c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3849	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3614c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3615c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3615c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3615c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) B. Sidders, C. Pirson et al. Screening of highly expressed mycobacterial genes identifies Rv3615c as a useful differential diagnostic antigen for the Mycobacterium tuberculosis complex. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3614c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3614c	active	darhngu	2012-10-05
	Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008