Rv3678c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3678c

Protein Domains

Gene Information
Locus	Rv3678c
Symbol
Gene Name	conserved hypothetical protein
Location	4118059 - 4118514 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:456 bp Protein:152 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29028
Related Genes	Acel_1999 CE0285 cg0339 DIP0301 jk1974 MAP0396 MAV_0451 Mkms_4906 ML2304 Mmcs_4820 MSMEG_6191 MT3779 MUL_4252 Mvan_5437 nfa3440 PPA0221 SAV4588
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3678c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3678c Transcript 1
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPE
EGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVF
GDSGAHARSAVGVSELPLDAPVEVELIVEVG*

Genomic Sequence

>Rv3678c
ATGAGCGCTAAAGCCCGATTAGGGCAACTCGGTGTCACGCTACCGCAAGTGGCGGCGCCG
CTGGCGGCCTACGTTCCAGCTGTGCGCACCGGCAACCTGGTCTACACCGCGGGCCAGCTG
CCGTTGGAGGCAGGCAAGCTGGTGCGGACCGGCAAGCTCGGCGCCGACGTCAACCCGGAG
GAGGGCAAGACGCTCGCGCGGATCTGCGCGCTCAATGCGCTGGCAGCCGTTGATTCGCTG
GTGGATCTCGACGCGGTGACCCGGGTGGTCAAAGTCGTCGGGTTTGTCGCTTCGGCACCG
GGGTTTCACGGCCAGCCGAGCGTGATCAACGGGGCCTCCGATCTGCTGGCCGAGGTGTTC
GGCGATAGCGGCGCGCATGCGCGTTCGGCGGTCGGCGTATCCGAGCTACCGTTGGATGCG
CCGGTGGAAGTCGAGTTGATCGTGGAGGTCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3418c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3417c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2590	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0551c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009