Rv3681c - transcriptional regulator whib-like whiB4

Expression: Most Significant Conditions for Rv3681c

Protein Domains

Gene Information
Locus	Rv3681c
Symbol	whiB4
Gene Name	transcriptional regulator whib-like whiB4
Location	4121198 - 4121554 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:357 bp Protein:119 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35604
Related Genes	Acel_2003 CE0283 cg0337 DIP0299 jk1976 MAP0393 MAV_0447 Mkms_4910 ML2307 Mmcs_4824 MSMEG_6199 MT3783 MUL_4256 Mvan_5441 nfa3400 PPA0220 SAV4584
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3681c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3681c Transcript 1
MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICR
HCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG*

Genomic Sequence

>Rv3681c
GTGTCAGGAACCCGTCCAGCCGCTCGAAGGACTAACCTCACGGCTGCACAGAACGTGGTA
CGCAGCGTAGACGCGGAAGAGCGGATCGCGTGGGTATCCAAGGCGCTGTGCCGGACTACC
GACCCTGACGAACTCTTTGTTCGAGGAGCCGCACAACGCAAGGCCGCGGTGATCTGCCGT
CACTGTCCGGTAATGCAAGAGTGTGCGGCAGATGCGCTGGACAACAAGGTCGAGTTCGGT
GTTTGGGGTGGCATGACCGAGCGCCAGCGCAGGGCTCTGCTCAAGCAACATCCCGAGGTG
GTTTCGTGGTCGGACTACCTTGAGAAGCGCAAGCGCCGCACCGGCACCGCCGGATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3252c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3251c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3250c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3249c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009