Rv3794 - membrane indolylacetylinositol arabinosyltransferase embA

Expression: Most Significant Conditions for Rv3794

Protein Domains

Gene Information
Locus	Rv3794
Symbol	embA
Gene Name	membrane indolylacetylinositol arabinosyltransferase embA
Location	4243233 - 4246517 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:3285 bp Protein:1095 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13003
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3794
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3794 Transcript 1
MPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITA
PLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDTGKAGLFVRANQDTVVVAFRD
SVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVG
AQPGLSARVDIDTRFITTPGALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRY
RPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVA
VFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSIALGRLAPAAVAIIVATLTAT
LAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVA
ESARIKYKVGPTIAWYQDFLRYYFLTVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGR
VAGLASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLL
AAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAGEVGSMAKAAVFRYPLYTTAK
ANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGED
LKSDPVVSKPGLVNSDASPNKPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVM
GSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPR
VPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIAELPQYRILPDHKQTAASSNL
WQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVIT
VPGWGRPGPIRALP*

Genomic Sequence

>Rv3794
GTGCCCCACGACGGTAATGAGCGATCTCACCGGATCGCACGCCTAGCAGCCGTCGTCTCG
GGAATCGCGGGTCTGCTGCTGTGCGGCATCGTTCCGCTGCTTCCGGTGAACCAAACCACC
GCGACCATCTTCTGGCCGCAGGGCAGCACCGCCGACGGCAACATCACCCAGATCACCGCC
CCTCTGGTATCCGGGGCGCCACGCGCGCTGGACATCTCGATCCCCTGCTCGGCCATCGCC
ACGCTGCCCGCCAACGGCGGCCTGGTGCTGTCCACACTGCCGGCCGGTGGCGTGGATACC
GGTAAGGCCGGGCTGTTCGTCCGCGCCAACCAGGACACGGTCGTCGTGGCGTTCCGCGAC
TCGGTGGCCGCGGTGGCGGCCCGCTCCACGATCGCAGCGGGAGGCTGTAGCGCGCTGCAT
ATCTGGGCCGATACCGGCGGCGCGGGCGCTGATTTTATGGGTATACCCGGCGGCGCCGGG
ACCCTGCCGCCGGAGAAGAAGCCACAGGTTGGCGGCATCTTCACCGACCTGAAGGTCGGA
GCGCAGCCCGGGCTGTCGGCCCGCGTCGACATCGACACTCGGTTTATCACGACGCCCGGC
GCGCTCAAGAAGGCCGTGATGCTCCTCGGCGTGCTGGCGGTCCTGGTAGCCATGGTGGGG
CTGGCCGCGCTGGACCGGCTCAGCAGGGGCCGCACCCTGCGCGACTGGCTGACCCGATAT
CGCCCGCGGGTGCGGGTCGGATTCGCCAGCCGGCTCGCTGACGCAGCGGTGATCGCGACC
TTGTTGCTCTGGCATGTCATCGGCGCCACCTCGTCCGATGACGGCTACCTTCTGACCGTC
GCCCGGGTCGCCCCGAAGGCCGGCTATGTAGCCAACTACTACCGGTATTTCGGCACGACG
GAGGCGCCGTTCGACTGGTATACATCGGTGCTTGCCCAGCTGGCGGCGGTGAGCACCGCC
GGCGTCTGGATGCGCCTGCCCGCCACCCTGGCCGGAATCGCCTGCTGGCTGATCGTCAGC
CGTTTCGTGCTGCGGCGGCTGGGACCGGGCCCGGGCGGGCTGGCGTCCAACCGGGTCGCT
GTGTTCACCGCTGGTGCGGTGTTCCTGTCCGCCTGGCTGCCGTTCAACAACGGCCTGCGT
CCCGAGCCGCTGATCGCGCTGGGTGTGCTGGTCACGTGGGTGTTGGTGGAACGGTCGATC
GCGCTCGGACGGCTGGCCCCGGCCGCGGTAGCCATCATCGTGGCGACGCTTACCGCGACG
CTGGCACCGCAGGGGTTGATCGCGCTGGCCCCGCTGCTGACTGGTGCGCGCGCCATCGCC
CAGAGGATCCGGCGCCGCCGGGCGACCGATGGACTGCTGGCGCCGCTGGCGGTGCTGGCC
GCGGCGTTGTCGCTGATCACCGTGGTGGTGTTTCGGGACCAGACGCTGGCCACGGTGGCC
GAATCGGCACGCATCAAGTACAAGGTCGGCCCGACCATCGCCTGGTACCAGGACTTCCTG
CGCTACTACTTCCTTACCGTGGAGAGCAACGTTGAGGGGTCGATGTCCCGCCGGTTCGCG
GTGCTGGTGTTGCTGTTCTGCCTGTTCGGGGTGCTGTTCGTGCTGCTGCGGCGCGGCCGG
GTGGCGGGGCTGGCCAGCGGCCCGGCCTGGCGACTGATCGGCACTACGGCGGTCGGCCTG
CTGCTGCTCACGTTCACGCCAACCAAGTGGGCCGTGCAGTTCGGCGCATTCGCCGGGCTG
GCCGGGGTGTTGGGTGCGGTCACCGCGTTCACCTTTGCCCGCATCGGTCTACATAGTCGA
CGCAACCTCACGCTGTACGTGACCGCGTTGCTGTTCGTGCTGGCGTGGGCAACCTCGGGC
ATCAACGGGTGGTTCTACGTCGGCAACTACGGGGTGCCGTGGTATGACATCCAGCCCGTC
ATCGCCAGCCACCCGGTGACGTCGATGTTTCTGACGCTGTCGATCCTCACCGGATTGCTG
GCAGCCTGGTATCACTTCCGGATGGACTACGCCGGGCACACCGAAGTCAAAGACAACCGG
CGCAACCGCATCTTGGCCTCTACGCCACTGCTGGTGGTCGCGGTGATCATGGTCGCAGGC
GAAGTCGGCTCGATGGCCAAGGCCGCGGTGTTCCGTTACCCGCTTTACACCACCGCCAAG
GCCAACCTGACCGCGCTCAGCACCGGGCTGTCCAGCTGTGCGATGGCCGACGACGTGCTG
GCCGAGCCCGACCCCAATGCCGGCATGCTGCAACCGGTTCCGGGCCAGGCGTTCGGACCG
GACGGACCGCTGGGCGGTATCAGTCCCGTCGGCTTCAAACCCGAGGGCGTGGGCGAGGAC
CTCAAGTCCGACCCGGTGGTCTCCAAACCCGGGCTGGTCAACTCCGATGCGTCGCCCAAC
AAACCCAACGCCGCCATCACCGACTCCGCGGGCACCGCCGGAGGGAAGGGCCCGGTCGGG
ATCAACGGGTCGCACGCGGCGCTGCCGTTCGGATTGGACCCGGCACGTACCCCGGTGATG
GGCAGCTACGGGGAGAACAACCTGGCCGCCACGGCCACCTCGGCCTGGTACCAGTTACCG
CCCCGCAGCCCGGACCGGCCGCTGGTGGTGGTTTCCGCGGCCGGCGCCATCTGGTCCTAC
AAGGAGGACGGCGATTTCATCTACGGCCAGTCCCTGAAACTGCAGTGGGGCGTCACCGGC
CCGGACGGCCGCATCCAGCCACTGGGGCAGGTATTTCCGATCGACATCGGACCGCAACCC
GCGTGGCGCAATCTGCGGTTTCCGCTGGCCTGGGCGCCGCCGGAGGCCGACGTGGCGCGC
ATTGTCGCCTATGACCCGAACCTGAGCCCTGAGCAATGGTTCGCCTTCACCCCGCCCCGG
GTTCCGGTGCTGGAATCTCTGCAGCGGTTGATCGGGTCAGCGACACCGGTGTTGATGGAC
ATCGCGACCGCAGCCAACTTCCCCTGCCAGCGACCGTTTTCCGAGCATCTCGGCATTGCC
GAGCTTCCGCAGTACCGGATCCTGCCGGACCACAAGCAGACGGCGGCGTCGTCGAACCTA
TGGCAGTCCAGCTCGACCGGCGGTCCGTTCCTGTTCACCCAGGCGCTGCTGCGCACCTCG
ACGATCGCCACGTACCTGCGTGGGGACTGGTATCGCGACTGGGGATCGGTGGAGCAGTAC
CACCGGCTGGTGCCGGCCGATCAGGCTCCAGACGCCGTTGTCGAGGAGGGCGTGATCACT
GTGCCCGGCTGGGGTCGGCCAGGACCGATCAGGGCGCTGCCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	active	njamshidi	2012-10-05
	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv1267c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1267c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv1267c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv1267c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1267c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv1267c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	ashwinigbhat	2012-10-05
	VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	active	priti.priety	2012-10-05
	VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv1267c	active	priyadarshinipriyanka2001	2012-10-05
	Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv1266c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol	active	mjackson	2012-10-05
	Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol	active	mjackson	2012-10-05
	Arabinosyltransferases
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
Term	GO:0052636 arabinosyltransferase activity - NR	active	mmcneil	2012-03-05
	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. J. Am. Chem. Soc. 2007
Term	GO:0052636 arabinosyltransferase activity - NR	active	mmcneil	2012-03-05
	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005