Rv3891c - Esat-6 like protein esxD

Expression: Most Significant Conditions for Rv3891c

Protein Domains

Gene Information
Locus	Rv3891c
Symbol	esxD
Gene Name	Esat-6 like protein esxD
Location	4374049 - 4374372 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:324 bp Protein:108 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9284
Related Genes	MAP0160 MAV_0153 MT4006
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3891c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3891c Transcript 1
MADTIQVTPQMLRSTANDIQANMEQAMGIAKGYLANQENVMNPATWSGTGVVASHMTATE
ITNELNKVLTGGTRLAEGLVQAAALMEGHEADSQTAFQALFGASHGS*

Genomic Sequence

>Rv3891c
GTGGCAGACACAATTCAGGTAACACCGCAGATGCTGCGCAGCACCGCCAACGATATCCAG
GCGAATATGGAGCAAGCCATGGGAATCGCCAAGGGCTACCTAGCCAACCAGGAAAACGTC
ATGAACCCCGCCACCTGGTCTGGTACCGGCGTCGTTGCTTCGCATATGACAGCCACCGAG
ATCACCAATGAATTGAACAAGGTCCTTACCGGGGGCACGCGCCTGGCCGAGGGCCTCGTG
CAGGCCGCAGCCCTGATGGAGGGACACGAGGCGGACTCGCAGACAGCGTTTCAGGCGCTG
TTCGGCGCTAGCCACGGATCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Structural Analysis NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3890c	active	shahanup86	2012-10-05
	Spectrophotometric NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001