Rv3913 - thioredoxin reductase trxB2

Expression: Most Significant Conditions for Rv3913

Protein Domains

Gene Information
Locus	Rv3913
Symbol	trxB2
Gene Name	thioredoxin reductase trxB2
Location	4401728 - 4402735 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1008 bp Protein:336 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37835
Related Genes	Acel_2148 BL0649 CE2933 cg3422 DIP2373 jk2093 MAP4339 MAV_5301 Mkms_5491 ML2703 Mmcs_5402 MSMEG_6933 MT4032 MUL_5066 Mvan_6067 nfa56620 PPA2309 SAV4305 SCO6834
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3913
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3913 Transcript 1
MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVEN
YPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVIL
AMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARS
VTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTA
AGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR*

Genomic Sequence

>Rv3913
ATGACCGCCCCGCCTGTCCATGACCGCGCACACCACCCCGTTCGCGACGTGATCGTTATC
GGCTCCGGTCCCGCGGGGTACACTGCGGCGCTCTACGCCGCCCGTGCCCAGCTGGCGCCG
CTGGTCTTCGAGGGCACGTCTTTCGGCGGCGCGCTGATGACCACCACCGACGTGGAGAAC
TACCCGGGATTTCGCAACGGCATCACCGGTCCAGAGTTGATGGATGAGATGCGGGAACAG
GCGCTGCGATTCGGCGCGGACCTGCGTATGGAAGACGTCGAGTCGGTATCACTTCACGGG
CCGCTGAAATCGGTCGTCACCGCCGACGGACAGACCCACCGGGCCCGAGCCGTGATCCTG
GCAATGGGCGCAGCGGCACGCTATCTGCAGGTGCCCGGCGAACAGGAATTGCTCGGGCGC
GGGGTGAGCTCGTGCGCCACCTGCGACGGATTCTTCTTCCGCGATCAGGACATCGCCGTC
ATCGGCGGCGGTGACTCGGCAATGGAGGAAGCTACCTTCCTGACCCGATTCGCTCGCAGT
GTGACGCTGGTGCATCGCCGCGACGAGTTCCGGGCTTCCAAAATCATGCTCGATCGCGCC
CGCAACAACGACAAGATACGGTTCCTCACCAACCACACCGTGGTCGCGGTGGACGGGGAC
ACCACAGTGACCGGCTTGCGGGTACGCGACACCAACACCGGTGCCGAAACCACCCTGCCG
GTAACCGGTGTTTTCGTCGCGATCGGCCACGAGCCGCGGTCGGGCTTGGTGCGCGAGGCC
ATCGACGTCGACCCGGACGGCTACGTGTTGGTGCAGGGGCGTACCACCAGCACCTCACTG
CCGGGCGTGTTCGCTGCCGGCGACCTGGTGGATCGCACCTATCGCCAGGCGGTTACCGCA
GCGGGCAGTGGCTGCGCCGCGGCTATCGACGCCGAGCGCTGGCTCGCCGAGCACGCAGCA
ACCGGAGAAGCTGACAGTACCGACGCATTGATAGGAGCACAACGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv0182c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006