Rv3914 - thioredoxin trxC

Expression: Most Significant Conditions for Rv3914

Protein Domains

Gene Information
Locus	Rv3914
Symbol	trxC
Gene Name	thioredoxin trxC
Location	4402732 - 4403082 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:351 bp Protein:117 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34368
Related Genes	Acel_2149 CE2934 cg3423 DIP2374 jk2094 MAP4340 MAV_5302 Mkms_5492 Mmcs_5403 MSMEG_6934 MT4033 MUL_5067 Mvan_6068 nfa56630 PPA2314 SAV4306
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3914
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3914 Transcript 1
MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTV
AKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN*

Genomic Sequence

>Rv3914
ATGACCGATTCCGAGAAGTCCGCCACCATCAAAGTTACCGACGCATCCTTTGCCACCGAC
GTGCTATCCAGCAACAAGCCTGTGCTGGTTGACTTTTGGGCGACATGGTGTGGACCTTGC
AAGATGGTAGCGCCCGTTCTCGAGGAAATCGCCACCGAGCGCGCAACAGACCTCACCGTC
GCCAAGCTCGACGTGGACACCAACCCGGAGACCGCCCGCAACTTCCAGGTCGTCTCGATC
CCTACCCTGATCTTGTTCAAGGACGGCCAGCCGGTGAAACGAATCGTTGGCGCCAAGGGT
AAGGCTGCGTTGCTGCGCGAGCTCTCAGACGTGGTTCCCAACCTCAACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001