Rv0006 - DNA gyrase subunit A gyrA

Expression: Most Significant Conditions for Rv0006

Protein Domains

Gene Information
Locus	Rv0006
Symbol	gyrA
Gene Name	DNA gyrase subunit A gyrA
Location	7302 - 9818 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2517 bp Protein:839 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32698
Related Genes	Acel_0006 BL0634 CE0015 cg0015 DIP0009 jk0011 MAP0006 MAV_0006 Mkms_0015 ML0006 Mmcs_0007 MSMEG_0006 MT0006 MUL_0006 Mvan_0007 nfa70 PPA0010 SAV4322
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0006
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0006 Transcript 1
MTDTTLPPDDSLDRIEPVDIEQEMQRSYIDYAMSVIVGRALPEVRDGLKPVHRRVLYAMF
DSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDSLVRMAQPWSLRYPLVDGQGNFGSPG
NDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEPTVLPSRFPNLLANGSGG
IAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGRVKGPDFPTAGLIVGSQGT
ADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHDNFITSIAEQVRDGKLAGIS
NIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTSFGANMLAIVDGVPRTLRLDQ
LIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALDALDEVIALIRASETVDIARAG
LIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKIEAEIADLEDILAKPERQRGIVR
DELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVVVTITETGYAKRTKTDLYRSQKRG
GKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRVYRAKAYDLPEASRTARGQHVANLL
AFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKSKLTDFDSNRSGGIVAVNLRDNDELV
GAVLCSAGDDLLLVSANGQSIRFSATDEALRPMGRATSGVQGMRFNIDDRLLSLNVVREG
TYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTVMYDRRRGRLVGALIVDDDSELYAVTSG
GGVIRTAARQVRKAGRQTKGVRLMNLGEGDTLLAIARNAEESGDDNAVDANGADQTGN*

Genomic Sequence

>Rv0006
ATGACAGACACGACGTTGCCGCCTGACGACTCGCTCGACCGGATCGAACCGGTTGACATC
GAGCAGGAGATGCAGCGCAGCTACATCGACTATGCGATGAGCGTGATCGTCGGCCGCGCG
CTGCCGGAGGTGCGCGACGGGCTCAAGCCCGTGCATCGCCGGGTGCTCTATGCAATGTTC
GATTCCGGCTTCCGCCCGGACCGCAGCCACGCCAAGTCGGCCCGGTCGGTTGCCGAGACC
ATGGGCAACTACCACCCGCACGGCGACGCGTCGATCTACGACAGCCTGGTGCGCATGGCC
CAGCCCTGGTCGCTGCGCTACCCGCTGGTGGACGGCCAGGGCAACTTCGGCTCGCCAGGC
AATGACCCACCGGCGGCGATGAGGTACACCGAAGCCCGGCTGACCCCGTTGGCGATGGAG
ATGCTGAGGGAAATCGACGAGGAGACAGTCGATTTCATCCCTAACTACGACGGCCGGGTG
CAAGAGCCGACGGTGCTACCCAGCCGGTTCCCCAACCTGCTGGCCAACGGGTCAGGCGGC
ATCGCGGTCGGCATGGCAACCAATATCCCGCCGCACAACCTGCGTGAGCTGGCCGACGCG
GTGTTCTGGGCGCTGGAGAATCACGACGCCGACGAAGAGGAGACCCTGGCCGCGGTCATG
GGGCGGGTTAAAGGCCCGGACTTCCCGACCGCCGGACTGATCGTCGGATCCCAGGGCACC
GCTGATGCCTACAAAACTGGCCGCGGCTCCATTCGAATGCGCGGAGTTGTTGAGGTAGAA
GAGGATTCCCGCGGTCGTACCTCGCTGGTGATCACCGAGTTGCCGTATCAGGTCAACCAC
GACAACTTCATCACTTCGATCGCCGAACAGGTCCGAGACGGCAAGCTGGCCGGCATTTCC
AACATTGAGGACCAGTCTAGCGATCGGGTCGGTTTACGCATCGTCATCGAGATCAAGCGC
GATGCGGTGGCCAAGGTGGTGATCAATAACCTTTACAAGCACACCCAGCTGCAGACCAGC
TTTGGCGCCAACATGCTAGCGATCGTCGACGGGGTGCCGCGCACGCTGCGGCTGGACCAG
CTGATCCGCTATTACGTTGACCACCAACTCGACGTCATTGTGCGGCGCACCACCTACCGG
CTGCGCAAGGCAAACGAGCGAGCCCACATTCTGCGCGGCCTGGTTAAAGCGCTCGACGCG
CTGGACGAGGTCATTGCACTGATCCGGGCGTCGGAGACCGTCGATATCGCCCGGGCCGGA
CTGATCGAGCTGCTCGACATCGACGAGATCCAGGCCCAGGCAATCCTGGACATGCAGTTG
CGGCGCCTGGCCGCACTGGAACGCCAGCGCATCATCGACGACCTGGCCAAAATCGAGGCC
GAGATCGCCGATCTGGAAGACATCCTGGCAAAACCCGAGCGGCAGCGTGGGATCGTGCGC
GACGAACTCGCCGAAATCGTGGACAGGCACGGCGACGACCGGCGTACCCGGATCATCGCG
GCCGACGGAGACGTCAGCGACGAGGATTTGATCGCCCGCGAGGACGTCGTTGTCACTATC
ACCGAAACGGGATACGCCAAGCGCACCAAGACCGATCTGTATCGCAGCCAGAAACGCGGC
GGCAAGGGCGTGCAGGGTGCGGGGTTGAAGCAGGACGACATCGTCGCGCACTTCTTCGTG
TGCTCCACCCACGATTTGATCCTGTTCTTCACCACCCAGGGACGGGTTTATCGGGCCAAG
GCCTACGACTTGCCCGAGGCCTCCCGGACGGCGCGCGGGCAGCACGTGGCCAACCTGTTA
GCCTTCCAGCCCGAGGAACGCATCGCCCAGGTCATCCAGATTCGCGGCTACACCGACGCC
CCGTACCTGGTGCTGGCCACTCGCAACGGGCTGGTGAAAAAGTCCAAGCTGACCGACTTC
GACTCCAATCGCTCGGGCGGAATCGTGGCGGTCAACCTGCGCGACAACGACGAGCTGGTC
GGTGCGGTGCTGTGTTCGGCCGGCGACGACCTGCTGCTGGTCTCGGCCAACGGGCAGTCC
ATCAGGTTCTCGGCGACCGACGAGGCGCTGCGGCCAATGGGTCGTGCCACCTCGGGTGTG
CAGGGCATGCGGTTCAATATCGACGACCGGCTGCTGTCGCTGAACGTCGTGCGTGAAGGC
ACCTATCTGCTGGTGGCGACGTCAGGGGGCTATGCGAAACGTACCGCGATCGAGGAATAC
CCGGTACAGGGCCGCGGCGGTAAAGGTGTGCTGACGGTCATGTACGACCGCCGGCGCGGC
AGGTTGGTTGGGGCGTTGATTGTCGACGACGACAGCGAGCTGTATGCCGTCACTTCCGGC
GGTGGCGTGATCCGCACCGCGGCACGCCAGGTTCGCAAGGCGGGACGGCAGACCAAGGGT
GTTCGGTTGATGAATCTGGGCGAGGGCGACACACTGTTGGCCATCGCGCGCAACGCCGAA
GAAAGTGGCGACGATAATGCCGTGGACGCCAACGGCGCAGACCAGACGGGCAATTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	InhibitedBy Rv1338	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) S. Sengupta, M. Shah et al. Glutamate racemase from Mycobacterium tuberculosis inhibits DNA gyrase by affecting its DNA-binding. Nucleic Acids Res. 2006
Interaction	PhysicalInteraction Rv0007	active	gaat3s	2012-10-05
	authors,M. Strong,D. Eisenberg The protein network as a tool for finding novel drug targets. Prog Drug Res 2007
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) UH. Manjunatha, S. Mahadevan et al. Monoclonal antibodies to mycobacterial DNA gyrase A inhibit DNA supercoiling activity. Eur. J. Biochem. 2001
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Aubry, XS. Pan et al. Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. Antimicrob. Agents Chemother. 2004
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) X. Yin & Z. Yu Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. The Journal of infection 2010
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) S. Niemann, D. Harmsen et al. Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. J. Clin. Microbiol. 2000
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) HE. Takiff, L. Salazar et al. Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. Antimicrob. Agents Chemother. 1994
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) KS. Goh, M. Fabre et al. Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. Mol. Cell. Probes null
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction	PhysicalInteraction Rv0005	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. Nucleic Acids Res. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3648c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3648c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
TB Drug Resistance Term	RIF	active	cstolte	2011-01-03
TB Drug Resistance Term	AMI	active	cstolte	2011-01-03