Rv0014c - transmembrane serine/threonine-protein kinase B pknB

Expression: Most Significant Conditions for Rv0014c

Protein Domains

Gene Information
Locus	Rv0014c
Symbol	pknB
Gene Name	transmembrane serine/threonine-protein kinase B pknB
Location	15590 - 17470 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1881 bp Protein:627 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36628
Related Genes	MAP0016c MAV_0017 Mkms_0023 ML0016 Mmcs_0015 MSMEG_0028 MT0017 MUL_0018 Mvan_0023 nfa800
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0014c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0014c Transcript 1
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
DACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTA
QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARH
EGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSA
AGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDV
QVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNV
STGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAI
TNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPP
AGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQH
NRVVYQNPPAGTGVNRDGIITLRFGQ*

Genomic Sequence

>Rv0014c
ATGACCACCCCTTCCCACCTGTCCGACCGCTACGAACTTGGCGAAATCCTTGGATTTGGG
GGCATGTCCGAGGTCCACCTGGCCCGCGACCTCCGGTTGCACCGCGACGTTGCGGTCAAG
GTGCTGCGCGCTGATCTAGCCCGCGATCCCAGTTTTTACCTTCGCTTCCGGCGTGAGGCG
CAAAACGCCGCGGCATTGAACCACCCTGCAATCGTCGCGGTCTACGACACCGGTGAAGCC
GAAACGCCCGCCGGGCCATTGCCCTACATCGTCATGGAATACGTCGACGGCGTTACCCTG
CGCGACATTGTCCACACCGAAGGGCCGATGACGCCCAAACGCGCCATCGAGGTCATCGCC
GACGCCTGCCAAGCGCTGAACTTCAGTCATCAGAACGGAATCATCCACCGTGACGTCAAG
CCGGCGAACATCATGATCAGCGCGACCAATGCAGTAAAGGTGATGGATTTCGGCATCGCC
CGCGCCATTGCCGACAGCGGCAACAGCGTGACCCAGACCGCAGCAGTGATCGGCACGGCG
CAGTACCTGTCACCCGAACAGGCCCGGGGTGATTCCGTCGACGCCCGATCCGATGTCTAT
TCCTTGGGCTGTGTTCTTTATGAAGTCCTCACCGGGGAGCCACCTTTCACCGGCGACTCA
CCCGTCTCGGTTGCCTACCAACATGTGCGCGAAGACCCGATCCCACCTTCGGCGCGGCAC
GAAGGCCTCTCCGCCGACCTGGACGCCGTCGTTCTCAAGGCGCTGGCCAAAAATCCGGAA
AACCGCTATCAGACAGCGGCGGAGATGCGCGCCGACCTGGTCCGCGTGCACAACGGTGAG
CCGCCCGAGGCGCCCAAAGTGCTCACCGATGCCGAGCGGACCTCGCTGCTGTCGTCTGCG
GCCGGCAACCTTAGCGGTCCGCGCACCGATCCGCTACCACGCCAGGACTTAGACGACACC
GACCGTGACCGCAGCATCGGTTCGGTGGGCCGTTGGGTTGCGGTGGTCGCCGTGCTCGCT
GTGCTGACCGTCGTGGTAACCATCGCCATCAACACGTTCGGCGGCATCACCCGCGACGTT
CAAGTTCCCGACGTTCGGGGTCAATCCTCCGCCGACGCCATCGCCACACTGCAAAACCGG
GGCTTCAAAATCCGCACCTTGCAGAAGCCGGACTCGACAATCCCACCGGACCACGTTATC
GGCACCGACCCGGCCGCCAACACGTCGGTGAGTGCAGGCGACGAGATCACAGTCAACGTG
TCCACCGGACCCGAGCAACGCGAAATACCCGACGTCTCCACGCTGACATACGCCGAAGCG
GTCAAGAAACTGACTGCCGCCGGATTCGGCCGCTTCAAGCAAGCGAATTCGCCGTCCACC
CCGGAACTGGTGGGCAAGGTCATCGGGACCAACCCGCCAGCCAACCAGACGTCGGCCATC
ACCAATGTGGTCATCATCATCGTTGGCTCTGGTCCGGCGACCAAAGACATTCCCGATGTC
GCGGGCCAGACCGTCGACGTGGCGCAGAAGAACCTCAACGTCTACGGCTTCACCAAATTC
AGTCAGGCCTCGGTGGACAGCCCCCGTCCCGCCGGCGAGGTGACCGGCACCAATCCACCC
GCAGGCACCACAGTTCCGGTCGATTCAGTCATCGAACTACAGGTGTCCAAGGGCAACCAA
TTCGTCATGCCCGACCTATCCGGCATGTTCTGGGTCGACGCCGAACCACGATTGCGCGCG
CTGGGCTGGACCGGGATGCTCGACAAAGGGGCCGACGTCGACGCCGGTGGCTCCCAACAC
AACCGGGTCGTCTATCAAAACCCGCCGGCGGGGACCGGCGTCAACCGGGACGGCATCATC
ACGCTGAGGTTCGGCCAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,OW. Schonecke,W. Schüffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
Interaction	ActivatedBy Rv1827	active	madhulsbu	2012-10-05
	Structural Analysis A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
Interaction	ActivatedBy Rv1827	active	madhulsbu	2012-10-05
	Spectrophotometric A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Structural Analysis authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Structural Analysis authors,H. Nürnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Structural Analysis authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Spectrophotometric authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Spectrophotometric authors,H. Nürnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
Interaction	Signaling Rv1436	active	yashabhasin	2012-10-05
	Spectrophotometric authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
Interaction	Inhibits Rv1222	active	harsharohiratruefriend	2012-10-05
	mass spectrometry R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	Inhibits Rv1222	active	harsharohiratruefriend	2012-10-05
	mass spectrometry S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
Interaction	PhysicalInteraction Rv1018c	active	ashwinigbhat	2012-10-05
	Structural Analysis A. Parikh, SK. Verma et al. PknB-Mediated Phosphorylation of a Novel Substrate, N-Acetylglucosamine-1-Phosphate Uridyltransferase, Modulates Its Acetyltransferase Activity. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv1018c	active	ashwinigbhat	2012-10-05
	Structural Analysis W. Zhang, VC. Jones et al. Expression, essentiality, and a microtiter plate assay for mycobacterial GlmU, the bifunctional glucosamine-1-phosphate acetyltransferase and N-acetylglucosamine-1-phosphate uridyltransferase. Int. J. Biochem. Cell Biol. 2008
Interaction	PhysicalInteraction Rv1018c	active	priti.priety	2012-10-05
	Structural Analysis A. Parikh, SK. Verma et al. PknB-Mediated Phosphorylation of a Novel Substrate, N-Acetylglucosamine-1-Phosphate Uridyltransferase, Modulates Its Acetyltransferase Activity. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv1018c	active	priti.priety	2012-10-05
	Structural Analysis W. Zhang, VC. Jones et al. Expression, essentiality, and a microtiter plate assay for mycobacterial GlmU, the bifunctional glucosamine-1-phosphate acetyltransferase and N-acetylglucosamine-1-phosphate uridyltransferase. Int. J. Biochem. Cell Biol. 2008
Interaction	Signaling Rv0020c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) C. Grundner, LM. Gay et al. Mycobacterium tuberculosis serine/threonine kinases PknB, PknD, PknE, and PknF phosphorylate multiple FHA domains. Protein Sci. 2005
Interaction	Signaling Rv0019c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis M. Gupta,A. Sajid,G. Arora,V. Tandon,Y. Singh Forkhead-associated domain-containing protein Rv0019c and polyketide-associated protein PapA5, from substrates of serine/threonine protein kinase PknB to interacting proteins of Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Signaling Rv0018c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis B. Boitel, M. Ortiz-Lombardía et al. PknB kinase activity is regulated by phosphorylation in two Thr residues and dephosphorylation by PstP, the cognate phospho-Ser/Thr phosphatase, in Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Signaling Rv0018c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis P. Chopra, B. Singh et al. Phosphoprotein phosphatase of Mycobacterium tuberculosis dephosphorylates serine-threonine kinases PknA and PknB. Biochem. Biophys. Res. Commun. 2003
Interaction	Activation Rv0016c	active	vmevada102	2012-10-05
	Co-expression (Functional linkage) A. Dasgupta, P. Datta et al. The serine/threonine kinase PknB of Mycobacterium tuberculosis phosphorylates PBPA, a penicillin-binding protein required for cell division. Microbiology (Reading, Engl.) 2006
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Functional linkage (Co-expression) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Functional linkage (Co-expression) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv3221A	active	jgalag	2012-10-05
	Affinity purification (Physical interaction) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Signaling Rv1827	active	akankshajain.21	2012-10-05
	Structural Analysis A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
Interaction	Signaling Rv1827	active	akankshajain.21	2012-10-05
	Spectrophotometric A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0016c	active	vmevada102	2012-10-05
	Co-expression (Functional linkage) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0016c	active	vmevada102	2012-10-05
	Co-expression (Functional linkage) A. Dasgupta, P. Datta et al. The serine/threonine kinase PknB of Mycobacterium tuberculosis phosphorylates PBPA, a penicillin-binding protein required for cell division. Microbiology (Reading, Engl.) 2006
Name	TRANSMEMBRANE SERINE/THREONINE-PROTEIN KINASE, known to phosphorylate InhA;KasA, KasB	active	mjackson	2012-10-05
	Regulatory proteins