Rv0019c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0019c

Protein Domains

Gene Information
Locus	Rv0019c
Symbol
Gene Name	conserved hypothetical protein
Location	23270 - 23737 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:468 bp Protein:156 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35773
Related Genes	CE0038 cg0063 DIP0058 jk0042 MAP0022c MAV_0023 Mkms_0028 ML0021 Mmcs_0020 MSMEG_0034 MT0022 MUL_0023 Mvan_0028 nfa850
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0019c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0019c Transcript 1
MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHA
ARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLG
STNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP*

Genomic Sequence

>Rv0019c
ATGCAGGGGTTGGTACTGCAACTGACGCGTGCCGGATTCTTGATGTTGTTGTGGGTATTC
ATCTGGTCCGTGCTACGGATCTTGAAGACCGACATTTATGCGCCGACCGGCGCGGTCATG
ATGCGCCGCGGCCTGGCGCTGCGAGGGACGCTCTTAGGCGCGCGTCAGCGCCGGCACGCT
GCACGCTACCTGGTGGTGACCGAAGGTGCGTTGACTGGCGCGCGTATCACGCTGAGCGAA
CAGCCGGTGTTGATCGGGCGCGCCGACGACTCGACCCTGGTGCTGACCGACGACTACGCC
TCGACGCGGCACGCTCGGCTGTCTATGCGCGGCTCCGAGTGGTACGTCGAAGATCTAGGA
TCGACCAACGGCACTTACCTGGACAGGGCGAAGGTGACGACTGCGGTACGAGTTCCGATC
GGAACGCCGGTTCGCATCGGCAAAACTGCAATCGAGTTGCGCCCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis M. Gupta,A. Sajid,G. Arora,V. Tandon,Y. Singh Forkhead-associated domain-containing protein Rv0019c and polyketide-associated protein PapA5, from substrates of serine/threonine protein kinase PknB to interacting proteins of Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Signaling Rv2939	active	vmevada102	2012-10-05
	Spectrophotometric Analysis M. Gupta,A. Sajid,G. Arora,V. Tandon,Y. Singh Forkhead-associated domain-containing protein Rv0019c and polyketide-associated protein PapA5, from substrates of serine/threonine protein kinase PknB to interacting proteins of Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	FtsZ-interacting protein A, FipA	active	rslayden	2012-03-05
	FipA as an interacting partner of FtsZ and FtsQ K. Sureka, T. Hossain et al. Novel role of phosphorylation-dependent interaction between FtsZ and FipA in mycobacterial cell division. PLoS ONE 2010
Symbol	FipA	active	rslayden	2012-03-05
	FipA as an interacting partner of FtsZ and FtsQ K. Sureka, T. Hossain et al. Novel role of phosphorylation-dependent interaction between FtsZ and FipA in mycobacterial cell division. PLoS ONE 2010