Rv0056 - 50S ribosomal protein L9 rplI

Expression: Most Significant Conditions for Rv0056

Protein Domains

Gene Information
Locus	Rv0056
Symbol	rplI
Gene Name	50S ribosomal protein L9 rplI
Location	59409 - 59867 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:459 bp Protein:153 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	1149
Related Genes	Acel_2130 BL0413 CE2818 cg3306 DIP2289 jk2064 MAP0070 MAV_0077 Mkms_5456 ML2682 Mmcs_5367 MSMEG_6894 MT0062 MUL_0074 Mvan_6031 nfa55750 PPA2227 SAV4286
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0056
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0056 Transcript 1
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQADEIRRARETKSVR
DLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAIKKAGGPNLDKRIVRLP
KTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS*

Genomic Sequence

>Rv0056
ATGAAGCTCATTCTCACGGCCGATGTCGATCACCTCGGGTCCATCGGCGACACTGTCGAG
GTCAAGGACGGGTATGGCCGTAACTTTCTGCTCCCGCGCGGCCTGGCGATCGTCGCCTCG
CGCGGAGCCCAGAAGCAGGCTGACGAGATCCGCCGGGCCCGCGAAACCAAAAGCGTACGC
GACCTAGAGCACGCCAACGAGATCAAGGCGGCGATCGAGGCGCTCGGCCCGATAGCGCTG
CCGGTGAAGACTTCAGCTGATTCTGGGAAGTTGTTCGGCTCGGTGACCGCCGCAGATGTG
GTTGCTGCCATCAAGAAGGCCGGTGGACCAAACCTCGATAAGCGGATCGTTCGGCTGCCC
AAGACGCACATCAAGGCCGTGGGCACGCATTTTGTGTCGGTGCACCTGCACCCGGAAATC
GATGTCGAGGTATCGCTGGACGTCGTGGCGCAGAGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0053	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,DW. Hoffman,C. Davies,SE. Gerchman,JH. Kycia,SJ. Porter,SW. White,V. Ramakrishnan Crystal structure of prokaryotic ribosomal protein L9: a bi-lobed RNA-binding protein. EMBO J. 1994
Interaction	PhysicalInteraction Rv0055	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,DW. Hoffman,C. Davies,SE. Gerchman,JH. Kycia,SJ. Porter,SW. White,V. Ramakrishnan Crystal structure of prokaryotic ribosomal protein L9: a bi-lobed RNA-binding protein. EMBO J. 1994
Interaction	PhysicalInteraction Rv0053	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
Interaction	PhysicalInteraction Rv0055	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
Interaction	PhysicalInteraction Rv0055	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
Interaction	PhysicalInteraction Rv0055	active	vmevada102	2012-10-05
	Operon (Functional Linkage) authors,N. Ban,P. Nissen,J. Hansen,M. Capel,PB. Moore,TA. Steitz Placement of protein and RNA structures into a 5 A-resolution map of the 50S ribosomal subunit. Nature 1999
Interaction	PhysicalInteraction Rv0053	active	singhpankaj2116	2012-10-05
	Operon (Functional linkage) authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
Interaction	PhysicalInteraction Rv0053	active	singhpankaj2116	2012-10-05
	Operon (Functional linkage) PR. Jungblut, UE. Schaible et al. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Mol. Microbiol. 1999
Interaction	PhysicalInteraction Rv0053	active	singhpankaj2116	2012-10-05
	Operon (Functional linkage) HJ. Mollenkopf, PR. Jungblut et al. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Electrophoresis 1999
Interaction	PhysicalInteraction Rv0053	active	singhpankaj2116	2012-10-05
	Operon (Functional linkage) authors,K. Isono,M. Kitakawa Cluster of ribosomal protein genes in Escherichia coli containing genes for proteins S6, S18, and L9. Proc. Natl. Acad. Sci. U.S.A. 1978