Rv0097 - oxidoreductase

Expression: Most Significant Conditions for Rv0097

Protein Domains

Gene Information
Locus	Rv0097
Symbol
Gene Name	oxidoreductase
Location	106734 - 107603 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:870 bp Protein:290 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18939
Related Genes	ML1992 MT0106 MUL_4854 SAV607
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0097
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0097 Transcript 1
MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDVHPSPREFIKLGRIIG
QIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMPEPFAFSMVLPLAVPGH
DRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSDVYRPIGEVWDEINRTTP
PIKWPTVIRHPKTGQEILYICATGTTKIEDKDGNPVDPEVLQELMAATGQLDPEYQSPFI
HTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDGLKTPGYAA*

Genomic Sequence

>Rv0097
ATGACGCTTAAGGTCAAAGGCGAGGGACTCGGTGCGCAGGTCACAGGGGTCGATCCCAAG
AATCTGGACGATATAACCACCGACGAGATCCGGGATATCGTTTACACGAACAAGCTCGTT
GTGCTAAAAGACGTCCATCCGTCTCCGCGGGAGTTCATCAAACTCGGCAGGATAATTGGA
CAAATCGTTCCGTATTACGAACCCATGTACCATCACGAAGACCACCCGGAGATCTTTGTC
TCCTCCACTGAGGAAGGTCAGGGGGTCCCAAAAACCGGCGCGTTCTGGCATATCGACTAT
ATGTTTATGCCGGAACCTTTCGCGTTTTCCATGGTGCTGCCGCTGGCGGTGCCTGGACAC
GACCGCGGGACCTATTTCATCGATCTCGCCAGGGTCTGGCAGTCGCTGCCCGCCGCCAAG
CGAGACCCGGCCCGCGGAACCGTCAGCACCCACGACCCTCGACGCCACATCAAGATCCGA
CCCAGCGACGTCTACCGGCCCATCGGAGAGGTATGGGACGAGATCAACCGGACCACGCCC
CCAATAAAGTGGCCTACGGTCATCCGGCACCCAAAGACCGGCCAAGAGATCCTCTACATC
TGCGCGACGGGCACCACCAAGATCGAGGACAAGGACGGCAATCCGGTTGATCCGGAGGTG
CTGCAAGAACTCATGGCCGCGACCGGACAGCTCGATCCTGAGTACCAGTCGCCGTTCATA
CATACTCAGCACTACCAGGTTGGCGACATCATCTTGTGGGACAACCGGGTTCTCATGCAC
CGAGCGAAGCACGGCAGCGCCGCGGGCACTCTGACGACCTACCGCCTGACCATGCTTGAT
GGCCTCAAGACGCCGGGATACGCGGCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv0102	active	gaurisd10	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003