Rv0098 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0098

Protein Domains

Gene Information
Locus	Rv0098
Symbol
Gene Name	conserved hypothetical protein
Location	107600 - 108151 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:552 bp Protein:184 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8846
Related Genes	ML1993 MT0107 MUL_4855 SAV606
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0098
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0098 Transcript 1
MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFT
IGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLI
RKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEFWDENGGAASGEIELAAL
NIP*

Genomic Sequence

>Rv0098
ATGAGCCACACCGACTTGACGCCCTGCACACGGGTGCTGGCATCCAGCGGCACGGTTCCG
ATCGCAGAGGAACTGCTGGCCAGAGTGCTCGAGCCCTACTCCTGCAAAGGATGTCGCTAC
CTCATCGACGCACAGTACAGCGCCACCGAGGATTCGGTTCTTGCCTATGGCAACTTCACG
ATCGGTGAGTCCGCCTATATTCGAAGCACGGGGCACTTCAACGCGGTCGAACTGATTCTG
TGTTTCAATCAGCTCGCCTACAGCGCCTTCGCTCCGGCCGTCCTCAACGAGGAAATCCGG
GTGCTTCGCGGCTGGTCGATCGACGACTACTGCCAACACCAGCTCTCTAGCATGCTGATC
AGGAAGGCATCATCGCGGTTCAGAAAACCGCTGAACCCGCAAAAGTTCTCTGCCCGCCTC
CTGTGTCGAGATCTGCAGGTCATCGAACGAACCTGGCGCTATCTCAAGGTCCCGTGCGTC
ATCGAGTTCTGGGACGAGAACGGCGGGGCGGCGTCCGGTGAGATCGAACTAGCGGCCCTC
AACATTCCGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv0102	active	gaurisd10	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Name	PROBABLE FATTY ACYL CoA THIOESTERASE TYPE III, probably involved together with the enzymes encoded by the genes of the operon in the biosynthesis of a still unknown lipopeptide	active	mjackson	2012-10-05
	Claisen-type condensation
Symbol	fcoT	active	mjackson	2012-10-05
	Claisen-type condensation
Name	PROBABLE FATTY ACYL CoA THIOESTERASE TYPE III, probably involved together with the enzymes encoded by the genes of the operon in the biosynthesis of a still unknown lipopeptide	active	mjackson	2012-10-05
	Claisen-type condensation
Symbol	fcoT	active	mjackson	2012-10-05
	Claisen-type condensation
Term	EC:4.2.1.61 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005