Rv0099 - fatty-acid-CoA ligase fadD10

Expression: Most Significant Conditions for Rv0099

Protein Domains

Gene Information
Locus	Rv0099
Symbol	fadD10
Gene Name	fatty-acid-CoA ligase fadD10
Location	108156 - 109778 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1623 bp Protein:541 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30628
Related Genes	ML1994 MT0108 MUL_4856
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0099
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0099 Transcript 1
MGGKKFQAMPQLPSTVLDRVFEQARQQPEAIALRRCDGTSALRYRELVAEVGGLAADLRA
QSVSRGSRVLVISDNGPETYLSVLACAKLGAIAVMADGNLPIAAIERFCQITDPAAALVA
PGSKMASSAVPEALHSIPVIAVDIAAVTRESEHSLDAASLAGNADQGSEDPLAMIFTSGT
TGEPKAVLLANRTFFAVPDILQKEGLNWVTWVVGETTYSPLPATHIGGLWWILTCLMHGG
LCVTGGENTTSLLEILTTNAVATTCLVPTLLSKLVSELKSANATVPSLRLVGYGGSRAIA
ADVRFIEATGVRTAQVYGLSETGCTALCLPTDDGSIVKIEAGAVGRPYPGVDVYLAATDG
IGPTAPGAGPSASFGTLWIKSPANMLGYWNNPERTAEVLIDGWVNTGDLLERREDGFFYI
KGRSSEMIICGGVNIAPDEVDRIAEGVSGVREAACYEIPDEEFGALVGLAVVASAELDES
AARALKHTIAARFRRESEPMARPSTIVIVTDIPRTQSGKVMRASLAAAATADKARVVVRG
*

Genomic Sequence

>Rv0099
ATGGGAGGAAAGAAGTTTCAAGCTATGCCTCAGTTGCCATCTACCGTGCTGGACCGGGTC
TTCGAGCAGGCACGGCAGCAGCCGGAAGCAATCGCCTTGCGTCGCTGCGACGGCACTAGC
GCACTGCGGTACCGTGAACTCGTCGCCGAAGTTGGTGGCCTTGCCGCGGATTTGCGTGCC
CAGTCGGTTAGCCGGGGTTCTAGGGTGCTGGTCATTTCCGACAATGGACCCGAGACGTAC
CTGTCGGTGCTGGCGTGTGCAAAGCTCGGGGCGATCGCCGTCATGGCCGACGGCAATCTT
CCGATCGCAGCCATCGAACGATTCTGTCAGATCACCGACCCCGCAGCGGCTCTCGTCGCA
CCAGGGAGCAAGATGGCATCTTCCGCCGTTCCCGAGGCGCTGCACTCGATACCAGTGATC
GCGGTCGACATAGCCGCTGTTACACGGGAATCCGAGCATTCCTTGGATGCAGCCAGCCTC
GCCGGGAACGCGGACCAGGGGAGCGAGGATCCGCTGGCGATGATCTTCACCAGCGGTACC
ACGGGCGAGCCCAAGGCTGTGCTACTGGCCAACCGCACCTTCTTCGCCGTCCCGGACATC
TTGCAAAAAGAGGGTTTGAACTGGGTCACTTGGGTCGTCGGCGAAACCACCTACTCGCCG
CTGCCGGCGACGCACATCGGTGGACTGTGGTGGATACTTACCTGCCTGATGCACGGCGGG
TTGTGTGTCACCGGCGGCGAGAATACGACATCGTTGCTGGAGATTCTCACCACGAACGCG
GTGGCGACGACGTGCCTAGTGCCAACGCTTCTTTCGAAGTTAGTTTCTGAACTGAAGTCC
GCCAACGCGACGGTTCCCTCGCTGCGCCTAGTTGGATACGGTGGTTCGCGGGCGATCGCG
GCCGATGTGCGGTTTATCGAAGCTACCGGCGTGCGCACCGCACAGGTCTACGGATTGAGC
GAGACCGGTTGCACGGCTTTGTGTTTGCCGACCGATGACGGCTCGATCGTCAAGATCGAA
GCAGGTGCTGTTGGCCGTCCGTACCCTGGCGTGGACGTCTATCTTGCCGCTACCGATGGC
ATCGGCCCTACCGCCCCCGGCGCCGGCCCGTCCGCCTCGTTCGGCACGCTATGGATTAAG
TCACCGGCCAACATGCTGGGCTACTGGAACAATCCCGAACGCACCGCAGAGGTGCTGATT
GACGGCTGGGTGAACACCGGTGACCTGCTGGAGCGCCGCGAGGACGGCTTCTTCTACATC
AAGGGAAGATCCTCGGAGATGATCATCTGTGGTGGCGTGAACATTGCGCCCGACGAGGTC
GATCGCATCGCGGAGGGCGTGTCGGGCGTCCGCGAGGCCGCGTGCTACGAGATTCCTGAC
GAAGAGTTCGGCGCGCTGGTGGGCCTGGCCGTGGTCGCATCGGCAGAGCTTGACGAGTCG
GCAGCCCGGGCGCTCAAGCACACGATTGCGGCTCGTTTTCGACGGGAGTCCGAGCCGATG
GCGCGGCCGTCGACAATTGTGATCGTCACCGACATTCCACGAACGCAGTCCGGCAAGGTC
ATGCGGGCCTCGCTTGCAGCGGCGGCAACAGCAGACAAGGCCAGAGTGGTCGTTCGTGGC
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv0102	active	gaurisd10	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0096	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006