Rv0165c - transcriptional regulator, gntR-family

Expression: Most Significant Conditions for Rv0165c

Protein Domains

Gene Information
Locus	Rv0165c
Symbol
Gene Name	transcriptional regulator, gntR-family
Location	194144 - 194938 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:795 bp Protein:265 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31341
Related Genes	MAP3599c MAV_5020 Mkms_0123 Mmcs_0114 MSMEG_0124 MSMEG_0130 MUL_1058 Mvan_0130 Mvan_1986
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0165c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0165c Transcript 1
MIKHDVVWVTLWPERPNNKPPPSPRQVPGNPGPTLKVLASHVNAPLSAKPRSQLPLRRAQ
LSDEVAGHLRAAIMSGALRSGTFIRLDETAAELGVSVTPVREALLKLRGEGMVGLEPHRG
HVVLPLTRQDIDDIFWLQATIAQELATSATAHITDVEIDELDRINNALAGAIGSGDAKTI
ASIEFAFHRVFNKASRRIKLAWFLLNAARYMGAGVRGRPAMGRGRGEQSSAADRRAAPPR
HSRRNRAHRLAVHRWGTQADGGPG*

Genomic Sequence

>Rv0165c
TTGATAAAGCATGATGTTGTCTGGGTCACACTATGGCCTGAGCGGCCCAACAACAAGCCC
CCGCCAAGCCCCCGGCAAGTCCCCGGCAATCCCGGCCCGACCCTGAAAGTCCTGGCAAGC
CACGTGAACGCACCTCTATCGGCGAAGCCGCGGAGCCAGCTTCCCCTGCGCCGGGCACAG
TTGTCCGACGAGGTCGCGGGCCACCTGCGGGCCGCCATCATGTCGGGCGCCCTGCGCTCT
GGAACGTTCATCCGTCTCGACGAGACGGCAGCCGAGCTCGGAGTCAGCGTCACGCCGGTG
CGGGAGGCGCTGCTGAAACTGCGCGGTGAGGGGATGGTCGGGCTGGAGCCACATCGCGGC
CACGTGGTGCTGCCGTTGACCCGCCAAGACATCGACGACATTTTCTGGCTGCAGGCCACC
ATTGCCCAAGAACTTGCCACATCGGCCACCGCTCACATCACCGACGTTGAGATCGACGAG
CTGGACCGCATCAACAATGCGCTGGCCGGTGCTATCGGGTCCGGTGATGCCAAAACCATC
GCGTCGATCGAGTTCGCGTTCCACCGCGTCTTCAACAAAGCGAGCCGCCGGATCAAGTTG
GCCTGGTTCCTGCTTAATGCCGCGCGCTATATGGGCGCAGGTGTTCGCGGCCGACCCGCG
ATGGGGCGCGGACGCGGTGAACAGTCATCGGCAGCTGATCGCCGCGCTGCGCCGCCGCGA
CACAGCCGCCGTAATCGAGCACACCGTCTGGCAGTTCACCGATGGGGCACGCAGGCTGAC
GGAGGCCCTGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulates Rv0174	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0173	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0172	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0171	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0170	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0169	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0168	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulates Rv0167	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0178	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0177	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0176	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0175	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006