Rv0167 - hypothetical membrane protein yrbE1A

Expression: Most Significant Conditions for Rv0167

Protein Domains

Gene Information
Locus	Rv0167
Symbol	yrbE1A
Gene Name	hypothetical membrane protein yrbE1A
Location	196861 - 197658 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:798 bp Protein:266 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26542
Related Genes	MAP3602 MAV_5017 Mkms_0125 ML2587 Mmcs_0116 MSMEG_0132 MT0176 MUL_1060 Mvan_0132
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0167
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0167 Transcript 1
MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWREFILQCWFIMRVGFLP
TIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPLTTVLVVAGAGSTAICA
DLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGLVITVGLVGGFLFGVYLQ
NVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRGLTVRGGSKGLGTAVNETV
VLCVIALFAVNVILTTIGVRFGTGR*

Genomic Sequence

>Rv0167
GTGACGACGTCGACAACGCTTGGCGGTTACGTCCGCGACCAACTGCAAACCCCGCTGACC
CTCGTCGGTGGATTCTTTCGCATGTGTGTGCTGACTGGAAAGGCGCTGTTTCGCTGGCCG
TTCCAGTGGCGCGAGTTCATTCTGCAGTGCTGGTTCATCATGCGGGTCGGATTTTTACCG
ACGATCATGGTCTCGATACCGCTGACGGTGCTGTTGATCTTCACGCTCAATATTCTGCTG
GCCCAGTTCGGCGCGGCAGACATCTCCGGTTCCGGCGCGGCGATCGGCGCGGTCACCCAG
CTTGGCCCGCTGACAACGGTGCTGGTGGTCGCCGGCGCCGGATCCACGGCCATCTGCGCC
GACCTGGGTGCCCGCACCATCCGCGAGGAAATCGACGCGATGGAGGTGCTGGGCATCGAT
CCCATCCACCGTCTGGTGGTGCCGCGGGTGCTCGCCTCGATGCTGGTCGCCACGCTGCTC
AACGGCTTGGTGATCACCGTCGGCCTGGTCGGTGGCTTTCTCTTCGGTGTCTATCTGCAG
AACGTTTCGGGCGGCGCCTACCTTGCCACGCTGACCTTGATCACCGGCCTGCCCGAGGTG
GTCATCGCAACCATCAAAGCCGCAACGTTCGGCCTGATCGCGGGCCTTGTCGGCTGCTAT
CGGGGGCTGACCGTCCGTGGCGGTTCCAAGGGTCTTGGCACCGCCGTCAACGAGACCGTG
GTGCTGTGTGTGATTGCCCTGTTCGCCGTCAACGTGATCTTGACGACCATCGGTGTGCGA
TTCGGGACGGGGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0655	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Joshi,AK. Pandey,N. Capite,SM. Fortune,EJ. Rubin,CM. Sassetti Characterization of mycobacterial virulence genes through genetic interaction mapping. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001