Rv0285 - PE family protein

Expression: Most Significant Conditions for Rv0285

Protein Domains

Gene Information
Locus	Rv0285
Symbol	PE5
Gene Name	PE family protein
Location	349624 - 349932 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:309 bp Protein:103 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12625
Related Genes	MAP3781 MAV_4868 Mkms_0383 ML2534 Mmcs_0373 MSMEG_0618 MT0298 MUL_1207 Mvan_0414
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0285
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0285 Transcript 1
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVE
HAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG*

Genomic Sequence

>Rv0285
ATGACGTTGCGAGTGGTTCCGGAGGGGCTGGCCGCAGCCAGCGCTGCGGTGGAAGCGCTG
ACGGCGCGGTTGGCCGCCGCGCATGCGAGCGCAGCGCCGGTGATTACCGCGGTAGTGCCG
CCGGCGGCGGATCCGGTGTCGCTGCAGACCGCGGCCGGGTTCAGTGCACAGGGCGTCGAG
CACGCGGTCGTCACCGCCGAAGGTGTCGAAGAGCTGGGACGCGCCGGCGTTGGTGTGGGC
GAATCCGGCGCCAGCTACCTGGCCGGTGATGCGGCCGCCGCCGCTACGTACGGGGTCGTG
GGCGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,A. Zvi,N. Ariel,J. Fulkerson,JC. Sadoff,A. Shafferman Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. BMC medical genomics 2008
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Signaling Rv0286	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,A. Zvi,N. Ariel,J. Fulkerson,JC. Sadoff,A. Shafferman Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. BMC medical genomics 2008
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002