Rv0301 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0301

Protein Domains

Gene Information
Locus	Rv0301
Symbol
Gene Name	conserved hypothetical protein
Location	364044 - 364469 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:426 bp Protein:142 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18815
Related Genes	MT0314 MT0685 Rv0656c SAV5694
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0301
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0301 Transcript 1
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFRE
PPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDF
DAIAALTGQKTERLTHRPPSA*

Genomic Sequence

>Rv0301
GTGACTGACCAGCGCTGGCTGATCGACAAGTCGGCGCTGGTGCGGCTCACGGACAGCCCT
GACATGGAAATCTGGTCGAACCGGATCGAACGCGGCCTGGTACACATCACGGGCGTGACA
CGCTTGGAAGTAGGGTTCTCGGCCGAATGCGGGGAGATAGCGCGACGGGAGTTTCGTGAA
CCGCCGCTGTCTGCGATGCCCGTGGAATACCTAACCCCGAGAATTGAAGACCGTGCGCTC
GAGGTGCAGACCTTGCTTGCCGACCGCGGACACCACCGTGGCCCGTCGATCCCGGATCTG
CTCATCGCCGCGACAGCCGAACTGTCGGGCTTGACGGTACTGCACGTCGACAAGGACTTT
GACGCCATCGCCGCGCTTACCGGTCAGAAAACAGAACGGCTCACGCATCGCCCGCCTTCC
GCTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0300	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0300	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC2	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.
Other	stop:364469	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.
Other	start:364044	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.