Rv0379 - protein transport protein secE2

Expression: Most Significant Conditions for Rv0379

Protein Domains

Gene Information
Locus	Rv0379
Symbol	secE2
Gene Name	protein transport protein secE2
Location	455977 - 456192 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:216 bp Protein:72 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8870
Related Genes	MUL_0120
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0379
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0379 Transcript 1
MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLE
VSFKMRPAQPR*

Genomic Sequence

>Rv0379
ATGAGTGTGTACAAGGTGATCGACATCATCGGGACCAGCCCCACATCCTGGGAACAGGCG
GCGGCGGAGGCGGTCCAGCGGGCGCGGGATAGCGTCGATGACATCCGCGTCGCTCGGGTC
ATTGAGCAGGACATGGCCGTGGACAGCGCCGGCAAGATCACCTACCGCATCAAGCTCGAA
GTGTCGTTCAAGATGAGGCCGGCGCAACCGCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1440	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv1440	active	manish.srcp	2012-10-05
	authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv0732	active	manish.srcp	2012-10-05
	authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004