Rv0430 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0430

Protein Domains

Gene Information
Locus	Rv0430
Symbol
Gene Name	conserved hypothetical protein
Location	518733 - 519041 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:309 bp Protein:103 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	1050
Related Genes	Acel_0097 CE2576 cg3033 DIP2044 jk0262 MAP3919 MAV_4724 Mkms_0582 ML1927 Mmcs_0570 MSMEG_0833 MT0445 MUL_1377 Mvan_0733 nfa53000 PPA0452 SAV3938
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0430
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0430 Transcript 1
MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEAIKELFSMSATRYYQV
LNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT*

Genomic Sequence

>Rv0430
ATGGACAGCGCCATGGCGCGGGCAATTCGATCGGGGGACGACGCCGAGGTCGCCGATGGG
CTGACCCGGCGCGAGCACGACATCCTGGCGTTCGAACGTCAGTGGTGGAAGTTTGCCGGT
GTCAAGGAAGAAGCCATCAAAGAGTTGTTCTCCATGTCGGCGACGCGCTACTACCAAGTG
CTCAATGCGCTGGTGGATCGGCCCGAGGCGCTGGCCGCCGACCCGATGCTGGTAAAGCGG
TTGCGGCGGCTGCGCGCCAGTCGGCAGAAGGCGCGGGCCGCGCGACGCCTTGGCTTCGAG
GTGACCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003