Rv0451c - membrane protein mmpS4

Expression: Most Significant Conditions for Rv0451c

Protein Domains

Gene Information
Locus	Rv0451c
Symbol	mmpS4
Gene Name	membrane protein mmpS4
Location	541488 - 541910 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:423 bp Protein:141 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12672
Related Genes	MAP3946 MAV_4697 ML2377 MT0467
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0451c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0451c Transcript 1
MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENSKPFNPKHLTYEIFGP
PGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQGNSDSIGCRITVDGKV
RAERVSNEVNAYTYCLVKSA*

Genomic Sequence

>Rv0451c
GTGCTAATGCGGACTTGGATTCCACTGGTCATCCTGGTGGTGGTCATCGTCGGGGGCTTC
ACCGTGCACCGGATCCGCGGCTTCTTCGGCTCCGAAAACCGCCCGTCGTACTCCGACACC
AACCTGGAAAACAGCAAACCATTCAACCCTAAACACCTGACTTACGAGATCTTCGGACCC
CCCGGAACAGTCGCCGACATTAGTTATTTCGACGTCAATTCCGAGCCGCAACGGGTCGAT
GGAGCGGTGCTACCGTGGTCATTGCATATCACGACAAACGACGCGGCGGTGATGGGAAAT
ATCGTGGCACAAGGTAATAGCGACAGCATTGGCTGCCGAATCACGGTAGACGGCAAGGTC
AGGGCCGAGAGGGTTTCCAACGAAGTCAACGCCTATACTTACTGCTTGGTGAAGTCCGCG
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulatory Rv2711	active	priyadarshinipriyanka2001	2012-10-05
	GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	Regulatory Rv2711	active	priyadarshinipriyanka2001	2012-10-05
	B. Gold, GM. Rodriguez et al. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2711	active	priyadarshinipriyanka2001	2012-10-05
	P. Prakash, S. Yellaboina et al. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Bioinformatics 2005
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002