Rv0467 - isocitrate lyase icl

Expression: Most Significant Conditions for Rv0467

Protein Domains

Gene Information
Locus	Rv0467
Symbol	icl
Gene Name	isocitrate lyase icl
Location	557527 - 558813 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1287 bp Protein:429 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19557
Related Genes	Acel_1657 CE2232 cg2560 jk1933 MAP3961 MAV_4682 Mkms_0649 Mmcs_0636 MSMEG_0911 MSMEG_4393 MT0483 MUL_4536 Mvan_0801 nfa52300 SAV2043
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0467
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0467 Transcript 1
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH*

Genomic Sequence

>Rv0467
ATGTCTGTCGTCGGCACCCCGAAGAGCGCGGAGCAGATCCAGCAGGAATGGGACACGAAC
CCGCGCTGGAAGGACGTCACCCGCACCTACTCCGCCGAGGACGTCGTCGCCCTCCAGGGC
AGCGTGGTCGAGGAGCACACGCTGGCCCGCCGCGGTGCGGAGGTGCTGTGGGAGCAGCTG
CACGACCTCGAGTGGGTCAACGCGCTGGGCGCGCTGACCGGCAACATGGCCGTCCAGCAG
GTGCGCGCCGGCCTGAAGGCCATCTACCTGTCGGGCTGGCAGGTCGCCGGCGATGCCAAC
CTGTCCGGGCACACCTACCCCGACCAGAGCCTGTATCCCGCCAACTCGGTGCCGCAGGTG
GTCCGCCGGATCAACAACGCACTGCAGCGCGCCGACCAGATCGCCAAGATCGAGGGCGAT
ACTTCGGTGGAGAACTGGCTGGCGCCGATTGTCGCCGACGGCGAGGCCGGCTTTGGCGGC
GCGCTCAACGTCTACGAGCTGCAGAAAGCCCTGATCGCCGCGGGCGTTGCGGGTTCGCAC
TGGGAGGACCAGTTGGCCTCTGAGAAGAAGTGCGGCCACCTGGGCGGCAAGGTGTTGATC
CCGACCCAGCAGCACATCCGCACTTTGACGTCTGCTCGGCTCGCGGCCGATGTGGCTGAT
GTTCCCACGGTGGTGATCGCCCGTACCGACGCCGAGGCGGCCACGCTGATCACCTCCGAC
GTCGACGAGCGCGACCAGCCGTTCATCACCGGCGAGCGCACCCGGGAAGGCTTCTACCGC
ACCAAGAACGGCATCGAGCCTTGCATCGCTCGGGCGAAGGCCTACGCCCCGTTCGCCGAC
TTGATCTGGATGGAGACCGGTACCCCGGACCTCGAGGCCGCCCGGCAGTTCTCCGAGGCG
GTCAAGGCGGAGTACCCGGACCAGATGCTGGCCTACAACTGCTCGCCATCGTTCAACTGG
AAAAAGCACCTCGACGACGCCACCATCGCCAAGTTCCAGAAGGAGCTGGCAGCCATGGGC
TTCAAGTTCCAGTTCATCACGCTGGCCGGCTTCCATGCGCTGAACTACTCGATGTTCGAT
CTGGCCTACGGCTACGCCCAGAACCAGATGAGCGCGTATGTCGAACTGCAGGAACGCGAG
TTCGCCGCCGAAGAACGGGGCTACACCGCGACCAAGCACCAGCGCGAGGTCGGCGCCGGC
TACTTCGACCGGATTGCCACCACCGTGGACCCGAATTCGTCGACCACCGCGTTGACCGGT
TCCACCGAAGAGGGCCAGTTCCACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:ICL Isocitrate lyase - ISS	active	njamshidi	2012-10-05
	PMID: 10932251 V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Term	EC:4.1.3.1 Isocitrate lyase. - ISS	active	njamshidi	2012-10-05
	PMID: 10932251 V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Term	TBRXN:ICL Isocitrate lyase - IDA	active	njamshidi	2012-10-05
	PMID: 10932251 V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Term	EC:4.1.3.1 Isocitrate lyase. - IDA	active	njamshidi	2012-10-05
	PMID: 10932251 V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Structural Analysis J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Spectrophotometric J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0465c	active	priyadarshinipriyanka2001	2012-10-05
	Band shift JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Regulatory Rv0182c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0465c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0465c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0465c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Term	EC:4.1.3.30 Methylisocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host EJ. Muñoz-Elías, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006
Term	EC:4.1.3.1 Isocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host EJ. Muñoz-Elías, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006
Term	EC:4.1.3.30 Methylisocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype K. Höner Zu Bentrup, A. Miczak et al. Characterization of activity and expression of isocitrate lyase in Mycobacterium avium and Mycobacterium tuberculosis. J. Bacteriol. 1999
Term	EC:4.1.3.1 Isocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype K. Höner Zu Bentrup, A. Miczak et al. Characterization of activity and expression of isocitrate lyase in Mycobacterium avium and Mycobacterium tuberculosis. J. Bacteriol. 1999
Term	EC:4.1.3.30 Methylisocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:4.1.3.1 Isocitrate lyase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011