Rv0494 - transcriptional regulator, gntR-family

Expression: Most Significant Conditions for Rv0494

Protein Domains

Gene Information
Locus	Rv0494
Symbol
Gene Name	transcriptional regulator, gntR-family
Location	584695 - 585423 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:729 bp Protein:243 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30831
Related Genes	MT0514 MUL_4564 SAV4720
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0494
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0494 Transcript 1
MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPERDLAERLGVNRTSLR
QGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPDFLVELLEIRAALGPLI
GRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVLIHSTRNRALGLLYRWVE
HAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAATVEAYLNASALRMVKSYRD
RA*

Genomic Sequence

>Rv0494
TTGGTTGAGCCAATGAACCAGTCAAGTGTCTTTCAGCCGCCGGATCGGCAGCGGGTGGAT
GAGCGGATCGCGACGACGATCGCCGACGCCATCCTCGACGGCGTCTTCCCGCCGGGCTCG
ACCCTGCCGCCCGAGCGAGACCTGGCAGAGCGGCTCGGTGTCAACCGCACCTCGCTACGC
CAGGGTCTGGCGCGACTGCAACAGATGGGCCTGATCGAGGTGCGGCACGGCAGCGGCAGT
GTGGTCCGTGACCCCGAGGGGCTCACCCATCCCGCGGTGGTCGAGGCGCTGGTGCGCAAA
CTGGGCCCCGACTTCCTCGTCGAGTTGCTGGAGATCCGCGCGGCGTTAGGCCCGTTGATT
GGCCGCCTGGCGGCCGCCCGGAGCACGCCCGAGGATGCCGAGGCGTTGTGTGCGGCGCTG
GAAGTGGTGCAACAGGCGGACACGGCCGCGGCGCGGCAGGCAGCCGATCTTGCCTACTTC
CGGGTGCTCATCCACAGCACTCGCAACCGCGCATTGGGGTTGCTCTACCGCTGGGTGGAG
CACGCCTTCGGCGGCCGCGAGCATGCGCTCACCGGGGCCTACGACGACGCGGACCCAGTG
TTGACCGACCTGCGGGCGATCAACGGGGCGGTGCTGGCCGGTGACCCGGCGGCCGCTGCC
GCGACCGTCGAGGCGTATCTGAACGCCAGTGCGCTGCGCATGGTCAAGTCCTACCGCGAC
CGCGCTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulates Rv0572c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0173	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0144	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0572c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0173	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006