Rv0569 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0569

Protein Domains

Gene Information
Locus	Rv0569
Symbol
Gene Name	conserved hypothetical protein
Location	661003 - 661269 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:267 bp Protein:89 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18828
Related Genes	Mkms_1101 Mmcs_1084 MSMEG_4361 MT0595
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0569
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0569 Transcript 1
MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETDHVATVIPGPDAVVVT
AEEQNAADERAQHRFGAVQSAILHARGT*

Genomic Sequence

>Rv0569
ATGAAGGCAAAGGTCGGGGACTGGCTGGTGATCAAAGGCGCGACGATAGATCAACCGGAC
CACCGAGGGTTGATTATTGAGGTGCGCTCATCCGATGGTTCGCCGCCGTATGTGGTGCGC
TGGCTCGAGACCGACCATGTGGCGACGGTGATTCCGGGTCCGGATGCGGTCGTGGTCACT
GCGGAGGAGCAGAATGCGGCCGACGAGCGGGCGCAGCATCGGTTCGGCGCGGTTCAGTCG
GCGATCCTCCATGCCAGGGGAACGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003