Rv0586 - transcriptional regulator, gntR-family

Expression: Most Significant Conditions for Rv0586

Protein Domains

Gene Information
Locus	Rv0586
Symbol
Gene Name	transcriptional regulator, gntR-family
Location	684410 - 685132 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:723 bp Protein:241 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29988
Related Genes	Acel_0574 MAP4081 MAV_2542 Mkms_0721 Mkms_2771 Mkms_2946 Mmcs_0707 Mmcs_2727 Mmcs_2902 MSMEG_3457 MSMEG_3527 MSMEG_4544 MT0615 MUL_1381 Mvan_2942 Mvan_2948 Mvan_2953 Mvan_2956 nfa1630 SAV2419
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0586
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0586 Transcript 1
MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPAVREALKRLSA
AGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSILEARLRNFPKVAELAA
ERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAGSIVDRLMYNAFRAAYEP
TLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLLELANTSLMAVLVSQASRQ
*

Genomic Sequence

>Rv0586
ATGGCGCTGCAGCCGGTGACTCGCCGATCGGTGCCCGAAGAGGTCTTCGAGCAGATCGCT
ACCGATGTGCTCACCGGCGAGATGCCGCCCGGCGAGGCGTTGCCCAGCGAGCGTCGGTTG
GCTGAGTTGCTCGGAGTGTCGCGACCCGCGGTCCGCGAGGCGCTCAAACGGCTGTCGGCC
GCAGGTCTGGTCGAGGTGCGTCAGGGCGACGTCACCACCGTGCGTGACTTCCGGCGGCAC
GCCGGCCTGGATCTGTTGCCCCGATTGTTGTTTCGCAACGGTGAGCTGGATATCTCCGTC
GTCCGCAGCATCCTCGAGGCCCGGCTGCGCAATTTTCCGAAGGTCGCGGAACTAGCGGCC
GAACGGAACGAGCCCGAGTTGGCGGAATTGCTGCAGGATTCGCTGCGTGCGCTGGACACT
GAGGAAGATCCGATCGTGTGGCAACGCCACACGCTCGACTTTTGGGATCATGTGGTCGAC
AGCGCCGGTTCGATCGTAGATCGATTGATGTACAACGCATTTCGTGCTGCTTACGAGCCG
ACGCTAGCTGCTCTGACCACCACGATGACCGCTGCGGCTAAGCGTCCGTCGGACTACCGG
AAACTCGCGGATGCGATCTGCTCAGGTGATCCCACCGGAGCGAAGAAAGCCGCCCAAGAC
CTACTCGAACTTGCGAACACATCGTTGATGGCCGTACTCGTTAGCCAGGCGAGTCGGCAA
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0670	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0594	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0593	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0592	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0591	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0590	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0589	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0670	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0594	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0593	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0592	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0591	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0590	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0589	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0670	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0594	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0593	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0592	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0591	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0590	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0589	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0670	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0594	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0593	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0592	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0591	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0590	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0589	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulates Rv1074c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0860	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0860	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0675	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0674	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0673	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0672	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0671	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0594	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0592	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0591	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0590	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0670	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0589	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0588	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0587	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0587	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	RegulatedBy Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	RegulatedBy Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulates Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008