Rv0590A - MCE-family related protein

Expression: Most Significant Conditions for Rv0590A

Protein Domains

Gene Information
Locus	Rv0590A
Symbol
Gene Name	MCE-family related protein
Location	688808 - 689062 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:255 bp Protein:85 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8883
Related Genes	MT0620
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0590A
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0590A Transcript 1
MLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYGDFFNFYLCDISLKVN
GLQPGGPVRTVKLFGQPTGRCTPQ*

Genomic Sequence

>Rv0590A
TTGCTGCACAGCAGCTTCGGGCACCTCGAGGGCATCCAGCAGCCGCTCATAGACGAGCTG
GCAGAACTCGACCACGTGTTGGGCAAGCTGCCGGACGCCTACCGGATCATCGGCCGCGCC
GGCGGCATATACGGTGACTTCTTCAACTTCTATCTGTGTGACATCTCACTGAAAGTCAAC
GGATTACAGCCTGGAGGTCCGGTACGCACCGTCAAGTTGTTCGGCCAGCCGACCGGCAGG
TGCACACCGCAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,M. Alonso-Hearn,TM. Eckstein,S. Sommer,LE. Bermudez A Mycobacterium avium subsp. paratuberculosis LuxR regulates cell envelope and virulence. Innate Immun 2010
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0592	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) AK. Das, D. Mitra et al. Predicted molecular structure of the mammalian cell entry protein Mce1A of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null