Rv0595c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0595c

Protein Domains

Gene Information
Locus	Rv0595c
Symbol
Gene Name	conserved hypothetical protein
Location	694839 - 695231 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:393 bp Protein:131 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11615
Related Genes	MT0625
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0595c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0595c Transcript 1
MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLST
YQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYA
AMPDVEVITI*

Genomic Sequence

>Rv0595c
GTGAACGTACGGCGCGCCCTCGCCGACACATCCGTTTTCATTGGCATCGAGGCGACACGA
TTCGACCCGGACCGGTTTGCGGGATACGAATGGGGCGTCTCGGTAGTCACACTCGGCGAG
CTGCGGCTCGGGGTGTTGCAAGCCTCCGGCCCCGAGGCCGCCGCACGTCGGCTCTCCACC
TACCAGCTTGCGCAACGGTTCGAACCACTAGGCATCGACGAGGCGGTCTCCGAAGCATGG
GCATTACTGGTGTCCAAGCTGCGCGCCGCCAAACTGCGCGTGCCGATCAACGACAGCTGG
ATTGCGGCCACAGCCGTGGCGCACGGCATTGCGATCCTGACCCAAGACAACGACTACGCC
GCCATGCCCGACGTCGAGGTCATAACGATCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,DJ. Beste,M. Espasa,B. Bonde,AM. Kierzek,GR. Stewart,J. McFadden The genetic requirements for fast and slow growth in mycobacteria. PLoS ONE 2009
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv0596c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,DJ. Beste,M. Espasa,B. Bonde,AM. Kierzek,GR. Stewart,J. McFadden The genetic requirements for fast and slow growth in mycobacteria. PLoS ONE 2009
Symbol	vapC-mt4	active	jlew	2012-03-07
	VapC-mt4 expression resulted in growth arrest in E coli, M. smeg and Mtb. Its expression led to translation inhibition accompanied by a gradual decrease in the steady-state levels of several mRNAs. VapC-mt4 exhibited sequence-specific endoribonuclease activity on mRNA templates at ACGC and AC(A/U)GC sequences. VapC-mt4 is mechanistically distinct from other TA toxins since it appears to primarily inhibit translation through selective, stable binding to RNA.. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth. authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik Growth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. The Journal of biological chemistry 2012
Symbol	VapC	active	jlew	2012-03-07
	Growth inhibitory in Mt and MS. In MS, not rescued by Rv2550c or Rv2830c. Rv0595c interacts with Rv0596c but not the other 3 VapBs, by Y2H. authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC4	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Q52562 plasmid stability protein from Pseudomonas syringae (139 aa), FASTA scores: opt: 131, E(): 0.0035, (35.2% identity in 88 aa overlap).
Other	stop:695231	active	rslayden	2012-03-05
	Q52562 plasmid stability protein from Pseudomonas syringae (139 aa), FASTA scores: opt: 131, E(): 0.0035, (35.2% identity in 88 aa overlap).
Other	start:694839	active	rslayden	2012-03-05
	Q52562 plasmid stability protein from Pseudomonas syringae (139 aa), FASTA scores: opt: 131, E(): 0.0035, (35.2% identity in 88 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other conserved hypothetical proteins e.g. Rv0627 (135 aa) and Rv0665 (112 aa) from Mycobacterium tuberculosis; and STBB_PSESM
Other	stop:695231	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other conserved hypothetical proteins e.g. Rv0627 (135 aa) and Rv0665 (112 aa) from Mycobacterium tuberculosis; and STBB_PSESM
Other	start:694839	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other conserved hypothetical proteins e.g. Rv0627 (135 aa) and Rv0665 (112 aa) from Mycobacterium tuberculosis; and STBB_PSESM