Rv0599c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0599c

Protein Domains

Gene Information
Locus	Rv0599c
Symbol
Gene Name	conserved hypothetical protein
Location	697564 - 697800 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:237 bp Protein:79 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6389
Related Genes	Mkms_0840 MT0629
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0599c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0599c Transcript 1
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATG
ETTIDDEVVFGLIDSGRK*

Genomic Sequence

>Rv0599c
ATGAAGGCTGTTGTGGATGCGGCTGGCCGCATCGTCGTACCCAAACCGCTGCGCGAAGCC
TTGGGGCTGCAACCGGGGTCCACCGTGGAAATATCCCGCTATGGCGCTGGTCTCCACCTG
ATTCCCACCGGACGAACAGCGCGTCTCGAAGAGGAGAATGGCGTACTGGTGGCCACCGGT
GAGACCACGATCGACGATGAGGTCGTGTTCGGCCTTATCGATAGCGGCCGGAAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv0598c	active	shahanup86	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0598c	active	shahanup86	2012-10-05
	authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv0598c	active	shahanup86	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0598c	active	shahanup86	2012-10-05
	authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	vapB-mt24	active	jlew	2012-03-07
	VapB-mt24 interacts with MazF-mt3 and VapC-mt25. mRNA levels elevated in Mtb in limited O2.. No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down. authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye Noncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. J. Biol. Chem. 2010