Rv0602c - two component system transcriptional regulator tcrA

Expression: Most Significant Conditions for Rv0602c

Protein Domains

Gene Information
Locus	Rv0602c
Symbol	tcrA
Gene Name	two component system transcriptional regulator tcrA
Location	699038 - 699799 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:762 bp Protein:254 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36469
Related Genes	MAP1102c MAV_3406 MT0631 Mvan_2389 SAV2970
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0602c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0602c Transcript 1
MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEEGHTVDTVADGRHAVA
AVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARGAVTDRIAGLDGGADDY
LTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRVWRADTEIRLSHKEFTLL
EALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDKIDRPFGVTSLETIRGAGY
RLRKDGGRHALPR*

Genomic Sequence

>Rv0602c
GTGGCAGATGAAACGACGATGAGAGCTGGTCGCGGCCCGGGCCGGGCATGCGGCAGGGTG
TCGGGTGTGCGCATCCTGGTGGTCGAGGACGAGCCCAAGATGACGGCGCTGCTGGCGCGG
GCGCTGACCGAGGAGGGCCACACGGTCGACACCGTTGCCGACGGCCGCCATGCGGTGGCG
GCCGTCGACGGCGGTGACTACGACGCGGTGGTGCTGGATGTGATGCTGCCCGGTATCGAC
GGGTTCGAGGTATGCGCGCGGCTGCGACGGCAGCGGGTGTGGACACCGGTGCTGATGCTT
ACCGCCCGCGGCGCGGTCACCGACCGCATCGCGGGCCTAGACGGCGGCGCCGACGATTAC
CTCACCAAACCGTTCAACCTCGACGAACTGTTCGCCCGGTTGCGCGCGCTGTCACGGCGC
GGGCCCATCCCACGCCCACCGACGCTGGAGGCCGGCGATCTACGCCTGGACCCGAGCGAA
CACCGAGTCTGGCGTGCCGACACCGAAATCCGGCTCAGTCACAAGGAATTCACCCTGCTG
GAAGCCCTGATCCGCCGTCCCGGCATCGTCCACACCCGCGCCCAGCTGCTGGAACGCTGC
TGGGACGCCGCCTACGAGGCCCGCTCCAACATCGTCGACGTCTACATCCGCTACCTGCGC
GACAAGATCGACCGGCCCTTCGGCGTCACCTCGCTGGAAACCATTCGCGGTGCCGGATAC
CGGCTGCGCAAGGACGGAGGACGGCATGCGCTCCCCCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0601c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Structural Analysis R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric M. Bhattacharya,A. Biswas,AK. Das Interaction analysis of TcrX/Y two component system from Mycobacterium tuberculosis. Biochimie 2010
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, DR. Das et al. Functional insights from the molecular modelling of a novel two-component system. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava & AK. Das Temperature and urea induced conformational changes of the histidine kinases from Mycobacterium tuberculosis. Int. J. Biol. Macromol. 2007
Interaction	Regulatory Rv0600c	active	shahanup86	2012-10-05
	Spectrophotometric R. Shrivastava, AK. Ghosh et al. Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. FEBS Lett. 2007