Rv0638 - preprotein translocase secE1

Expression: Most Significant Conditions for Rv0638

Protein Domains

Gene Information
Locus	Rv0638
Symbol	secE1
Gene Name	preprotein translocase secE1
Location	733737 - 734222 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:486 bp Protein:162 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	186
Related Genes	Acel_0293 BL1287 CE0485 cg0561 DIP0430 jk1862 MAP4110 MAV_4523 Mkms_0938 ML1907 Mmcs_0921 MSMEG_1344 MT0667 MUL_0724 Mvan_1233 nfa51170 PPA1892 RHA1_ro01981 SAV4908
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0638
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0638 Transcript 1
MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKRSRSRAAGADADVDVE
EPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAFVYNYLKQVVAEMRKVI
WPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG*

Genomic Sequence

>Rv0638
GTGAGCGACGAAGGCGACGTTGCCGACGAGGCCGTAGCCGACGGCGCCGAGAATGCGGAC
AGCCGCGGGAGCGGTGGCCGGACGGCCCTGGTGACAAAGCCGGTGGTGCGGCCGCAACGT
CCCACCGGCAAGCGGTCGCGGTCGCGTGCGGCAGGAGCCGACGCAGACGTCGACGTCGAA
GAGCCGTCGACCGCGGCTTCGGAAGCTACCGGGGTCGCCAAGGACGATTCGACCACCAAG
GCCGTGTCGAAGGCTGCCAGGGCAAAAAAGGCCAGTAAACCGAAGGCCCGGTCGGTTAAC
CCGATCGCATTCGTCTACAACTACCTCAAGCAGGTCGTTGCCGAGATGCGGAAGGTAATC
TGGCCGAACCGCAAACAAATGCTTACCTACACGTCGGTGGTGCTGGCGTTTCTGGCCTTC
ATGGTGGCGCTGGTCGCCGGTGCTGACTTGGGCCTGACCAAGCTGGTGATGTTGGTGTTC
GGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1440	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv0732	active	prabhakarsmail	2012-10-05
	Structural Analysis authors,KL. Bieker,TJ. Silhavy PrlA (SecY) and PrlG (SecE) interact directly and function sequentially during protein translocation in E. coli. Cell 1990
Interaction	PhysicalInteraction Rv0732	active	prabhakarsmail	2012-10-05
	Structural Analysis authors,EH. Manting,C. van Der Does,H. Remigy,A. Engel,AJ. Driessen SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J. 2000
Interaction	PhysicalInteraction Rv0732	active	akankshajain.21	2012-10-05
	Structural Analysis authors,KL. Bieker,TJ. Silhavy PrlA (SecY) and PrlG (SecE) interact directly and function sequentially during protein translocation in E. coli. Cell 1990
Interaction	PhysicalInteraction Rv0732	active	akankshajain.21	2012-10-05
	Structural Analysis authors,EH. Manting,C. van Der Does,H. Remigy,A. Engel,AJ. Driessen SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J. 2000
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008