Rv0656c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0656c

Protein Domains

Gene Information
Locus	Rv0656c
Symbol
Gene Name	conserved hypothetical protein
Location	752984 - 753367 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:384 bp Protein:128 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18815
Related Genes	MT0314 MT0685 Rv0301 SAV5694
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0656c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0656c Transcript 1
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPK
SVWRWIDSAQHRLARAGAVGALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVR
RVVSADD*

Genomic Sequence

>Rv0656c
TTGGCGGCTGCAACGACAACCGGAACCCACCGAGGCCTGGAACTCCGCGCTGCTCAGCGG
GCCGTCGGGTCGTGCGAACCGCAACGAGCCGAGTTCTGCCGATCAGCGCGGAATGCGGAC
GAGTTCGACCAGATGAGCCGGATGTTTGGTGACGTCTACCCCGATGTGCCAGTGCCGAAA
TCCGTGTGGCGGTGGATCGATTCGGCACAGCACCGCCTCGCCCGGGCGGGAGCGGTGGGT
GCCCTGTCGGTTGTCGATCTGCTGATCTGCGACACTGCGGCGGCCAGGGGCCTAGTAGTC
CTCCACGACGATGCCGACTACGAACTCGCAGAGCGTCACCTTCCCGACATCAGAGTGCGG
AGGGTCGTCAGCGCCGACGACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv0657c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0657c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0657c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0657c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC6	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with proteins from Mycobacterium tuberculosis e.g. Rv2757c, Rv2546, etc.
Other	stop:753367	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with proteins from Mycobacterium tuberculosis e.g. Rv2757c, Rv2546, etc.
Other	start:752984	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with proteins from Mycobacterium tuberculosis e.g. Rv2757c, Rv2546, etc.