Rv0664 - hypothetical protein

Expression: Most Significant Conditions for Rv0664

Protein Domains

Gene Information
Locus	Rv0664
Symbol
Gene Name	hypothetical protein
Location	758532 - 758804 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:273 bp Protein:91 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8899
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0664
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0664 Transcript 1
MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGA
HLRDELAKRSADPRLTDELNDLAGHTLDDL*

Genomic Sequence

>Rv0664
ATGGAAAAGTCACGGTGCCACGCTGTCGCACATGGAGGTGGGTGTGCGGGATCTGCGAAA
TCGCACAAGTCAGGTGGTCGATGCGGTCAAGGCCGGGGTGCCGGTGACTCTCACGGTACA
CGGGGAGCCGGTCGCCGATATCGTGCCGCATCGGCGCCGCATCCGCTGGCTGTCGGGGCG
CATCTGCGCGATGAGCTCGCCAAGCGCTCGGCCGACCCGCGCCTCACCGATGAACTCAAC
GACTTGGCCGGTCATACCCTCGACGACCTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0665	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0665	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0665	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0665	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapB8	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	stop:758804	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	start:758532	active	rslayden	2012-03-05
	Hypothetical unknown protein
Symbol	Vap BC-8	active	rslayden	2012-03-05
	Hypothetical unknown protein