Rv0678 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0678

Protein Domains

Gene Information
Locus	Rv0678
Symbol
Gene Name	conserved hypothetical protein
Location	778990 - 779487 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:498 bp Protein:166 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18684
Related Genes	MAV_2992 Mkms_2247 Mmcs_2201 MUL_0759 Mvan_0777 nfa16070 SAV4542
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0678
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0678 Transcript 1
MSVNDGVDQMGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLVCDPERQSSEELATAL
AASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAFAAGERERIRAMAELQDLADV
GLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQRTGEDD*

Genomic Sequence

>Rv0678
GTGAGCGTCAACGACGGGGTCGATCAGATGGGCGCCGAGCCCGACATCATGGAATTCGTC
GAACAGATGGGCGGCTATTTCGAGTCCAGGAGTTTGACTCGGTTGGCGGGTCGATTGTTG
GGCTGGCTGCTGGTGTGTGATCCCGAGCGGCAGTCCTCGGAGGAACTGGCGACGGCGCTG
GCGGCCAGCAGCGGGGGGATCAGCACCAATGCCCGGATGCTGATCCAATTTGGGTTCATT
GAGCGGCTCGCGGTCGCCGGGGATCGGCGCACCTATTTCCGGTTGCGGCCCAACGCTTTC
GCGGCTGGCGAGCGTGAACGCATCCGGGCAATGGCCGAACTGCAGGACCTGGCTGACGTG
GGGCTGAGGGCGCTGGGCGACGCCCCGCCGCAGCGAAGCCGACGGCTGCGGGAGATGCGG
GATCTGTTGGCATATATGGAGAACGTCGTCTCCGACGCCCTGGGGCGATACAGCCAGCGA
ACCGGAGAGGACGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1221	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv1221	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv1221	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv1221	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0677c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0676c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0677c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0677c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0676c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0676c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008