Rv0700 - 30S ribosomal protein S10 rpsJ

Expression: Most Significant Conditions for Rv0700

Protein Domains

Gene Information
Locus	Rv0700
Symbol	rpsJ
Gene Name	30S ribosomal protein S10 rpsJ
Location	800487 - 800792 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:306 bp Protein:102 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	202
Related Genes	Acel_0305 BL1577 CE0521 cg0593 DIP0472 jk1834 MAP4160 MAV_4472 Mkms_1029 ML1864 Mmcs_1012 MSMEG_1435 MT0727 MUL_0789 Mvan_1304 nfa7320 PPA1865 RHA1_ro06132 SAV4925
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0700
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0700 Transcript 1
MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPHKYKD
SREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ*

Genomic Sequence

>Rv0700
GTGGCGGGACAGAAGATCCGCATCAGGCTGAAGGCCTACGACCATGAGGCCATTGACGCT
TCGGCGCGCAAGATCGTCGAAACCGTCGTCCGCACCGGTGCCAGCGTCGTAGGGCCGGTG
CCGCTACCGACTGAGAAGAACGTGTATTGCGTCATCCGCTCACCGCATAAGTACAAGGAC
TCGCGGGAGCACTTCGAGATGCGCACACACAAGCGGTTGATCGACATCATCGATCCCACG
CCGAAGACCGTTGACGCGCTCATGCGCATCGACCTTCCGGCCAGCGTCGACGTCAACATC
CAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2533c	active	priyadarshinipriyanka2001	2012-10-05
	Structural Analysis B. Gopal, LF. Haire et al. The crystal structure of NusB from Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv2533c	active	priyadarshinipriyanka2001	2012-10-05
	Structural Analysis B. Gopal, RA. Cox et al. Crystallization and preliminary X-ray diffraction studies on the N-utilizing substance-B (NusB) from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2000
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0708	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0707	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	Regulatory Rv0703	active	ravirajsoni	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0348	active	ashwinigbhat	2012-10-05
	DNA Microarray Analysis B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	PhysicalInteraction Rv0639	active	jgalag	2012-10-05
	Structural Analysis B. Beuth, S. Pennell et al. Structure of a Mycobacterium tuberculosis NusA-RNA complex. EMBO J. 2005
Interaction	PhysicalInteraction Rv2841c	active	jgalag	2012-10-05
	Structural Analysis B. Beuth, S. Pennell et al. Structure of a Mycobacterium tuberculosis NusA-RNA complex. EMBO J. 2005
Interaction	PhysicalInteraction Rv2533c	active	jgalag	2012-10-05
	Structural Analysis B. Beuth, S. Pennell et al. Structure of a Mycobacterium tuberculosis NusA-RNA complex. EMBO J. 2005
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001