Rv0818 - transcriptional regulator

Expression: Most Significant Conditions for Rv0818

Protein Domains

Gene Information
Locus	Rv0818
Symbol
Gene Name	transcriptional regulator
Location	910972 - 911739 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:768 bp Protein:256 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32839
Related Genes	Acel_2025 BL0392 MAP0649 MAV_0760 Mkms_4612 Mmcs_4525 MSMEG_5784 MT0840 MUL_0435 Mvan_5097 nfa5980 PPA0344 SAV4042
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0818
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0818 Transcript 1
MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGL
CRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTGPAEIDARLRLVVGRRGDLAD
QESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWG
YDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPG
RDGMQEPLVDPLRSQ*

Genomic Sequence

>Rv0818
TTGTTGGAGTTATTACTGCTGACCTCGGAGCTGTATCCGGATCCGGTCCTGCCGGCGCTG
TCGCTGCTGCCCCACACCGTGCGGACGGCGCCGGCCGAGGCGTCTTCGTTGCTGGAGGCG
GGAAACGCAGACGCTGTGCTCGTCGACGCGCGCAACGACCTGTCGTCCGGGCGAGGCCTG
TGCCGCCTGTTGAGCTCGACCGGCCGGTCGATCCCGGTACTGGCGGTGGTGAGCGAAGGC
GGGCTGGTGGCGGTCAGCGCTGACTGGGGGCTGGACGAGATCCTGCTGCTCAGCACCGGG
CCCGCTGAGATCGACGCCAGACTGCGGCTGGTGGTTGGCCGGCGCGGAGATCTGGCTGAC
CAGGAGAGTCTGGGCAAGGTGAGCCTGGGCGAGCTGGTGATCGACGAAGGCACCTACACC
GCCCGGCTGCGTGGCCGCCCGCTGGATCTCACCTACAAAGAGTTCGAGCTGCTGAAATAC
CTGGCGCAGCATGCCGGCCGGGTGTTCACTCGGGCGCAGCTGCTGCACGAAGTATGGGGG
TATGACTTCTTCGGGGGCACCCGGACTGTTGATGTGCACGTGCGGCGGTTGCGGGCCAAA
CTCGGCCCCGAGCATGAAGCGCTGATCGGCACGGTGCGCAACGTCGGATACAAAGCTGTT
CGGCCGGCGCGCGGCCGACCGCCGGCCGCGGACCCCGACGACGAAGACGCCGATCCCGGC
CGGGATGGTATGCAAGAACCACTGGTCGACCCGTTGCGCAGTCAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3544c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3543c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3545c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3544c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3543c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3252c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3251c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3250c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3249c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1466	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1465	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1464	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1463	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1462	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1461	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1460	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009