Rv0821c - phosphate-transport system transcriptional regulator phoY2

Expression: Most Significant Conditions for Rv0821c

Protein Domains

Gene Information
Locus	Rv0821c
Symbol	phoY2
Gene Name	phosphate-transport system transcriptional regulator phoY2
Location	913558 - 914199 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:642 bp Protein:214 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33501
Related Genes	Acel_0090 CE2462 cg2842 DIP1904 jk0382 MAP0655c MAV_0768 Mkms_4601 ML2188 Mmcs_4514 MSMEG_5776 MT0843 MUL_0441 Mvan_5088 nfa6040 PPA0361 SAV3974
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0821c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0821c Transcript 1
MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAE
ESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGY
FAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAA
VDVTLLSRFYERFADHAVEVARRVIFQATGAFP*

Genomic Sequence

>Rv0821c
ATGCGGACCGCCTACCATGAGCAACTCTCGGAATTATCCGAGCGTCTCGGGGAAATGTGC
GGGCTAGCAGGCATCGCCATGGAGCGGGCCACCCAAGCCTTGCTGCAGGCCGATCTCGTG
CTGGCCGAGCAAGTGATCTCCGACCACGAAAAGATCGCGACGCTAAGCGCCCGGGCCGAG
GAGAGTGCATTCGTTCTTCTGGCGTTGCAGGCACCGGTCGCCGGTGACCTCAGAGCCATT
GTGAGCGCCATCCAGATGGTGGCTGACATCGACCGGATGGGGGCGTTGGCGCTGCATGTC
GCCAAGATCGCCCGCCGTCGGCATCCACAGCACGCGCTGCCCGAAGAGGTCAACGGTTAT
TTTGCCGAAATGGGAAGAGTTGCAGTCGAATTGGGCAACAGTGCCCAAGAGGTCGTGTTG
TCGCACGACCCGGAAAAGGCCGCCCAGATCCGCGAAGAAGACGACGCGATGGACGACCTG
CACCGGCATTTGTTCACCGTGCTGATGGACCGCGAATGGAAGCACGGAGTGGCGGCCGCC
GTCGACGTGACGTTGCTGAGCCGATTCTACGAGCGCTTTGCCGACCACGCCGTGGAAGTG
GCACGACGCGTGATCTTCCAGGCGACCGGCGCCTTTCCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0936	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0935	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0934	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0933	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0932c	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0930	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0929	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0928	active	diponlove	2012-10-05
	W. Shi,Y. Zhang PhoY2 but not PhoY1 is the PhoU homologue involved in persisters in Mycobacterium tuberculosis. The Journal of antimicrobial chemotherapy 2010
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006