Rv0886 - NADPH:adrenodoxin oxidoreductase fprB

Expression: Most Significant Conditions for Rv0886

Protein Domains

Gene Information
Locus	Rv0886
Symbol	fprB
Gene Name	NADPH:adrenodoxin oxidoreductase fprB
Location	983803 - 985530 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1728 bp Protein:576 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34694
Related Genes	MAP0825 MAV_1015 Mkms_4549 ML2134 Mmcs_4462 MSMEG_5681 MT0909 MUL_0264 Mvan_5031 nfa14090
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0886
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0886 Transcript 1
MPHVITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCGACVTACPVSA
IAPNTRLDFEQLPFVEINASYYPKRPAGVKLAPTSKLAPVTPAAEVRVRRQPLTVAVVGS
GPAAMYAADELLVQQGVQVNVFEKLPTPYGLVRSGVAPDHQNTKRVTRLFDRIAGHRRFR
FYLNVEIGKHLGHAELLAHHHAVLYAVGAPDDRRLTIDGMGLPGTGTATELVAWLNGHPD
FNDLPVDLSHERVVIIGNGNVALDVARVLAADPHELAATDIADHALSALRNSAVREVVVA
ARRGPAHSAFTLPELIGLTAGADVVLDPGDHQRVLDDLAIVADPLTRNKLEILSTLGDGS
APARRVGRPRIRLAYRLTPRRVLGQRRAGGVQFSVTGTDELRQLDAGLVLTSIGYRGKPI
PDLPFDEQAALVPNDGGRVIDPGTGEPVPGAYVAGWIKRGPTGFIGTNKSCSMQTVQALV
ADFNDGRLTDPVATPTALDQLVQARQPQAIGCAGWRAIDAAEIARGSADGRVRNKFTDVA
EMLAAATSAPKEPLRRRVLARLRDLGQPIVLTVPL*

Genomic Sequence

>Rv0886
ATGCCGCACGTAATTACTCAGTCGTGCTGCAACGACGCGTCCTGCGTCTTCGCATGTCCG
GTGAACTGCATCCACCCGACGCCGGACGAGCCGGGCTTCGCGACCTCGGAAATGCTCTAT
ATCGATCCGGTGGCCTGCGTGGACTGTGGTGCCTGCGTAACCGCCTGCCCGGTCAGCGCG
ATCGCGCCGAACACCCGGTTGGACTTCGAGCAGCTGCCGTTCGTCGAAATCAATGCGTCG
TATTACCCGAAGCGGCCCGCCGGCGTGAAGCTAGCGCCGACGTCGAAGCTGGCTCCGGTG
ACTCCGGCCGCCGAGGTGCGTGTGCGCCGGCAGCCGCTGACGGTAGCCGTCGTCGGGTCC
GGGCCCGCGGCGATGTATGCCGCCGATGAGCTGCTGGTCCAGCAGGGAGTGCAGGTCAAC
GTCTTTGAGAAGCTGCCGACACCCTACGGGCTGGTGCGCTCCGGGGTGGCGCCGGATCAC
CAGAACACCAAGCGGGTCACGCGACTATTTGACCGGATCGCCGGTCATCGCCGCTTCCGG
TTCTATCTCAACGTCGAGATCGGCAAGCATCTAGGCCATGCCGAGCTATTGGCCCACCAT
CACGCCGTGCTGTACGCGGTCGGAGCGCCCGACGACCGCCGGCTGACGATTGACGGGATG
GGACTGCCGGGCACCGGTACCGCCACGGAGCTGGTCGCGTGGCTCAACGGACATCCCGAC
TTCAACGATCTGCCAGTCGATCTCAGTCACGAACGCGTGGTGATCATCGGCAACGGGAAT
GTCGCGCTCGACGTGGCGCGCGTGCTTGCGGCCGATCCGCACGAGCTGGCCGCCACCGAC
ATCGCCGACCACGCGTTGTCCGCGTTACGCAACTCGGCGGTCCGTGAGGTGGTGGTCGCC
GCCCGCCGCGGTCCTGCCCATTCGGCGTTCACCCTGCCCGAGCTGATCGGGCTCACGGCC
GGAGCCGACGTCGTGCTTGACCCGGGAGATCATCAGCGAGTACTCGATGATCTGGCAATC
GTTGCCGATCCGTTGACCAGGAACAAGCTGGAGATCTTGAGCACGCTGGGGGACGGGTCG
GCGCCTGCGCGACGAGTCGGGCGCCCGCGGATCCGGCTGGCCTATCGGCTCACGCCGCGG
CGCGTCCTCGGCCAGCGGCGGGCCGGCGGAGTTCAGTTCTCGGTCACCGGAACCGACGAG
CTGCGCCAACTGGATGCTGGCCTGGTGCTGACGTCGATTGGCTACCGCGGCAAGCCGATT
CCCGACCTGCCGTTCGACGAGCAGGCCGCGCTCGTGCCCAACGATGGTGGACGGGTCATC
GACCCGGGCACCGGCGAGCCGGTGCCCGGCGCATACGTCGCGGGTTGGATCAAGCGCGGG
CCCACCGGGTTCATCGGCACGAACAAGTCCTGCTCTATGCAGACCGTTCAGGCGTTGGTG
GCCGACTTCAACGACGGCCGGCTGACCGATCCGGTGGCTACACCGACGGCGCTGGATCAG
CTGGTGCAGGCCCGCCAGCCCCAAGCCATCGGCTGTGCGGGATGGCGGGCCATCGACGCG
GCCGAGATTGCGCGCGGCAGCGCCGACGGCCGGGTCCGCAACAAGTTCACCGACGTCGCC
GAGATGCTCGCGGCAGCAACCAGCGCGCCTAAGGAACCGCTTCGGCGGCGCGTGCTGGCC
CGGCTGCGTGACCTGGGGCAGCCGATCGTGCTAACCGTCCCCTTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009