Rv0960 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0960

Protein Domains

Gene Information
Locus	Rv0960
Symbol
Gene Name	conserved hypothetical protein
Location	1073545 - 1073928 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:384 bp Protein:128 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28067
Related Genes	MT0988 PPA2073
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0960
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0960 Transcript 1
MIVVDASAALAALLNDGQARQLIAAERLHVPHLVDSEIASGLRRLAQRDRLGAADGRRAL
QTWRRLAVTRYPVVGLFERIWEIRANLSAYDASYVALAEALNCALVTADLRLSDTGQAQC
PITVVPR*

Genomic Sequence

>Rv0960
ATGATCGTCGTTGACGCCTCGGCCGCGCTGGCCGCGCTGCTCAACGATGGACAAGCTCGA
CAATTGATCGCTGCCGAGCGCCTGCATGTCCCGCATCTGGTCGATTCGGAAATCGCGAGC
GGGCTCCGCAGGCTAGCGCAGCGGGATCGGCTGGGCGCGGCCGACGGACGGCGGGCCCTC
CAAACGTGGCGCCGCCTCGCGGTGACGCGTTATCCGGTGGTGGGCCTTTTCGAGCGTATC
TGGGAAATCCGCGCGAACCTGTCGGCATACGACGCCAGCTATGTGGCCTTGGCGGAAGCC
CTGAACTGTGCGCTCGTCACAGCGGATCTGCGGCTCAGCGACACCGGCCAAGCCCAGTGT
CCGATTACCGTTGTGCCCAGGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Symbol	VapC9	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-14, (38.3% identity in 128 aa overlap), Rv1720c (129 aa), and Rv0549c (137 aa).
Other	stop:1073928	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-14, (38.3% identity in 128 aa overlap), Rv1720c (129 aa), and Rv0549c (137 aa).
Other	start:1073545	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-14, (38.3% identity in 128 aa overlap), Rv1720c (129 aa), and Rv0549c (137 aa).
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv0065
Other	stop:1073928	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv0065
Other	start:1073545	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv0065