Rv0991c - conserved serine rich protein

Expression: Most Significant Conditions for Rv0991c

Protein Domains

Gene Information
Locus	Rv0991c
Symbol
Gene Name	conserved serine rich protein
Location	1108172 - 1108504 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:333 bp Protein:111 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3774
Related Genes	Acel_0161 MAP0922c MAV_1100 Mkms_4378 ML0180 Mmcs_4292 MSMEG_5479 MT1020 MUL_4695 Mvan_4835 nfa49550 PPA2407 SAV3678
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0991c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0991c Transcript 1
MPTYSYECTQCANRFDVVQAFTDDALTTCERCSGRLRKLFNAVGVVFKGTGFYRTDSRES
GKKSKSQTNGSSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV*

Genomic Sequence

>Rv0991c
GTGCCAACCTACAGCTACGAGTGCACCCAGTGCGCCAACCGCTTCGATGTTGTGCAGGCC
TTCACCGACGATGCGCTGACCACGTGCGAGCGGTGTTCTGGCCGGCTGCGCAAGCTGTTC
AATGCGGTCGGCGTGGTGTTCAAAGGCACCGGCTTCTACCGCACCGACAGCCGCGAGTCG
GGCAAGAAGTCCAAGAGCCAGACCAACGGATCCTCGACCAGCGAGTCGACGAAGAGTTCG
GGGAGTTCGGGGAGTTCTGGCTCGAGTGAAAGCAAGGCTTCGGGGTCAACCGAGAAGTCA
ACCAGCTCCACAACCGCCGCCGCGGCCGTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0990c	active	raj252000	2012-10-05
	Co-expression GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	Regulatory Rv0990c	active	raj252000	2012-10-05
	Co-expression GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2374c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008