Rv1027c - transcriptional regulator kdpE

Expression: Most Significant Conditions for Rv1027c

Protein Domains

Gene Information
Locus	Rv1027c
Symbol	kdpE
Gene Name	transcriptional regulator kdpE
Location	1148427 - 1149107 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:681 bp Protein:227 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31967
Related Genes	jk1273 MAP0995c MAV_1169 Mkms_4296 Mmcs_4230 MSMEG_5396 MT1056 Mvan_4763 nfa15700 SAV2483
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1027c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1027c Transcript 1
MTLVLVIDDEPQILRALRINLTVRGYQVITASTGAGALRAAAEHPPDVVILDLGLPDMSG
IDVLGGLRGWLTAPVIVLSARTDSSDKVQALDAGADDYVTKPFGMDEFLARLRAAVRRNT
AAAELEQPVIETDSFTVDLAGKKVIKDGAEVHLTPTEWGMLEMLARNRGKLVGRGELLKE
VWGPAYATETHYLRVYLAQLRRKLEDDPSHPKHLLTESGMGYRFEA*

Genomic Sequence

>Rv1027c
ATGACCCTCGTCTTGGTGATTGACGACGAACCCCAGATCCTGCGCGCGCTGCGTATCAAC
CTGACCGTGCGTGGCTACCAGGTCATCACCGCCTCGACGGGTGCGGGTGCGCTGCGCGCC
GCCGCTGAGCATCCGCCCGATGTGGTGATCCTCGACCTCGGCCTGCCGGACATGTCGGGT
ATCGACGTGCTCGGCGGGCTGCGTGGCTGGTTGACGGCACCGGTGATCGTGTTGTCGGCG
CGTACCGATTCGTCGGACAAGGTCCAGGCCCTCGATGCGGGCGCCGACGATTACGTGACG
AAACCGTTTGGAATGGACGAGTTTCTGGCTCGGCTGCGCGCAGCGGTACGGCGTAACACC
GCGGCCGCCGAGTTGGAGCAGCCGGTGATCGAAACCGATTCATTCACCGTCGATCTGGCC
GGCAAGAAGGTCATCAAAGACGGTGCCGAAGTGCATCTCACGCCGACCGAGTGGGGCATG
CTGGAAATGCTGGCCCGCAACCGCGGCAAGTTGGTCGGCCGCGGGGAGCTTCTCAAAGAA
GTGTGGGGACCGGCATATGCGACTGAAACCCATTACCTGCGGGTGTATCTGGCGCAGCTG
CGGCGCAAATTGGAGGATGACCCGTCGCACCCCAAACATCTGCTGACCGAATCAGGGATG
GGCTACCGCTTCGAAGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1028c	active	akankshajain.21	2012-10-05
	Protein fragment complementation A. Singh, D. Mai et al. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Regulatory Rv1028c	active	akankshajain.21	2012-10-05
	Protein fragment complementation T. Parish, DA. Smith et al. Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv1028c	active	darhngu	2012-10-05
	Protein fragment complementation A. Singh, D. Mai et al. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Regulatory Rv1028c	active	darhngu	2012-10-05
	Protein fragment complementation T. Parish, DA. Smith et al. Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Signaling Rv1031	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1030	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1029	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1028A	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1031	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1030	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1029	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1028A	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Regulates Rv1031	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1030	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1029	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1031	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1030	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1029	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006