Rv1040c - PE family protein

Expression: Most Significant Conditions for Rv1040c

Protein Domains

Gene Information
Locus	Rv1040c
Symbol	PE8
Gene Name	PE family protein
Location	1162549 - 1163376 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:828 bp Protein:276 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11487
Related Genes	MT1069 MUL_4620
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1040c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1040c Transcript 1
MSFLKTVPEELTAAAAQLGTIGAAMAAQNAAAAAPTTAIAPAALDEVSALQAALFTAYGT
FYQQVSAEAQAMHDMFVNTLGISAGTYGVTESLNSSAAASPLSGITGEASAIIQATTGLF
PPELSGGIGNILNIGAGNWASATSTLIGLAGGGLLPAEEAAEAASALGGEAALGELGALG
AAEAALGEAGIAAGLGSASAIGMLSVPPAWAGQATLVSTTSTLPGAGWTAAAPQAAAGTF
IPGMPGVASAARNSAGFGAPRYGVKPIVMPKPATV*

Genomic Sequence

>Rv1040c
ATGTCATTCCTCAAGACAGTGCCTGAAGAGTTGACGGCTGCGGCCGCGCAACTCGGGACC
ATCGGTGCTGCGATGGCAGCCCAAAACGCTGCCGCCGCGGCGCCCACCACAGCCATCGCT
CCGGCGGCCCTCGATGAGGTTTCGGCGCTGCAGGCGGCGCTCTTCACTGCGTACGGCACC
TTCTACCAGCAGGTCAGCGCCGAAGCTCAGGCTATGCATGACATGTTTGTCAACACTCTG
GGAATCAGCGCCGGTACCTACGGCGTCACCGAGTCGCTCAACTCATCGGCTGCCGCCTCG
CCACTCTCGGGGATCACAGGGGAAGCGTCGGCCATCATCCAAGCGACGACGGGGTTGTTC
CCGCCCGAACTCTCGGGTGGCATTGGCAACATCCTCAACATCGGGGCCGGGAACTGGGCC
TCCGCCACGTCTACGCTGATCGGCCTTGCCGGCGGCGGCCTCCTGCCTGCAGAGGAGGCG
GCCGAGGCCGCCTCGGCTCTCGGTGGGGAAGCCGCCTTGGGCGAATTGGGTGCATTGGGC
GCGGCCGAAGCCGCCCTCGGCGAGGCCGGAATTGCGGCCGGCCTGGGCAGCGCATCCGCG
ATCGGCATGTTGTCGGTGCCGCCCGCCTGGGCCGGACAGGCGACCCTGGTATCCACCACC
AGCACACTGCCGGGCGCGGGCTGGACCGCCGCCGCGCCGCAGGCCGCCGCGGGGACGTTC
ATCCCCGGGATGCCAGGGGTGGCCTCGGCCGCACGCAACAGCGCCGGCTTCGGTGCACCG
CGCTACGGCGTCAAACCCATCGTCATGCCCAAGCCAGCAACCGTCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1039c	active	raj252000	2012-10-05
	Operon (Functional linkage) authors,R. Riley,M. Pellegrini,D. Eisenberg Identifying cognate binding pairs among a large set of paralogs: the case of PE/PPE proteins of Mycobacterium tuberculosis. PLoS Comput. Biol. 2008
Interaction	PhysicalInteraction Rv1039c	active	raj252000	2012-10-05
	Operon (Functional linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006