Rv1163 - respiratory nitrate reductase delta chain narJ

Expression: Most Significant Conditions for Rv1163

Protein Domains

Gene Information
Locus	Rv1163
Symbol	narJ
Gene Name	respiratory nitrate reductase delta chain narJ
Location	1292798 - 1293403 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:606 bp Protein:202 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28209
Related Genes	CE1294 cg1342 DIP0498 MAP2618c MAV_1305 Mkms_1278 Mmcs_1261 MSMEG_5138 MT1200 Mvan_4544 nfa45510 PPA0508 SCO6533
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1163
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1163 Transcript 1
MWQSASLLLAYPDDGLAERLHMVDALRAHQTGPAAALLGRTVAELRALAPMAAAAQYVET
FDMRRRSTMYLTYWTAGDTRNRGREMLAFATAYRDAGVKPPRTEAPDYLPVVLEFAATVD
PEAGRRLLTEHRVPIDVLRGALADAKSPYEYTVAAICETLPAATNQEVRRAQRLAQSGPP
AEAVGLQPFTLTVPPKRAEGA*

Genomic Sequence

>Rv1163
GTGTGGCAGTCGGCCTCGCTACTGCTGGCCTATCCGGATGACGGGCTGGCCGAGCGGCTG
CACATGGTCGATGCGCTGCGCGCCCACCAAACGGGCCCGGCGGCGGCGCTGCTAGGGCGA
ACGGTAGCGGAGTTGCGTGCCCTGGCGCCGATGGCCGCGGCGGCGCAGTACGTCGAGACC
TTCGATATGCGACGCCGATCCACGATGTATCTGACGTACTGGACCGCCGGGGACACCCGC
AACCGCGGCCGGGAGATGCTGGCGTTCGCCACCGCCTATCGAGACGCCGGCGTCAAGCCG
CCGCGTACCGAGGCGCCCGACTACCTGCCCGTCGTGCTCGAGTTCGCCGCCACCGTCGAC
CCCGAGGCCGGACGTCGGCTGCTGACCGAGCACCGTGTGCCGATCGACGTGTTGCGCGGC
GCGCTGGCCGACGCCAAGTCACCCTATGAGTACACCGTGGCGGCGATCTGCGAGACACTG
CCCGCTGCCACCAACCAGGAAGTGCGTCGGGCACAACGCCTAGCTCAGTCGGGGCCGCCC
GCGGAAGCCGTTGGTTTGCAACCGTTTACCTTGACCGTCCCGCCCAAGCGCGCCGAGGGG
GCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:NO3R2 Nitrate reductase (Menaquinol-8) - IPI	active	njamshidi	2012-10-05
	PMID: 12843072 M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Term	TBRXN:NO3R2 Nitrate reductase (Menaquinol-8) - ISS	active	njamshidi	2012-10-05
	PMID: 12843072 M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Term	TBRXN:NO3R1 Nitrate reductase (Ubiquinol-8) - IPI	active	njamshidi	2012-10-05
	PMID: 12843072 M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Term	TBRXN:NO3R1 Nitrate reductase (Ubiquinol-8) - ISS	active	njamshidi	2012-10-05
	PMID: 12843072 M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1164	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1162	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) authors,JF. Ghiglione,L. Philippot,P. Normand,R. Lensi,P. Potier Disruption of narG, the gene encoding the catalytic subunit of respiratory nitrate reductase, also affects nitrite respiration in Pseudomonas fluorescens YT101. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Operon (Functional linkage) M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction	PhysicalInteraction Rv1161	active	dreamsbeyondinfinity	2012-10-05
	Spectrophotometric Analysis CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003