Rv1185c - fatty-acid-CoA ligase fadD21

Expression: Most Significant Conditions for Rv1185c

Protein Domains

Gene Information
Locus	Rv1185c
Symbol	fadD21
Gene Name	fatty-acid-CoA ligase fadD21
Location	1325776 - 1327512 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1737 bp Protein:579 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21660
Related Genes	MAP2235 MAV_1759 ML1234 MT1222
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1185c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1185c Transcript 1
MSDSSVLSLLRERAGLQPDDAAFTYIDYEQDWAGITETLTWSEVFRRTRIVAHEVRRHCT
TGDRAVILAPQGLAYIAAFLGSMQAGAIAVPLSVPQIGSHDERVSAVLADASPSVILTTS
AVAEAVAEHIHRPNTNNVGPIIEIDSLDLTGNSPSFRVKDLPSAAYLQYTSGSTRAPAGV
MISHRNLQANFQQLMSNYFGDRNGVAPPDTTIVSWLPFYHDMGLVLGIIAPILGGYRSEL
TSPLAFLQRPARWLHSLANGSPSWSAAPNFAFELAVRKTTDADIEGLDLGNVLGITSGAE
RVHPNTLSRFCNRFAPYNFREDMIRPSYGLAEATLYVASRNSGDKPEVVYFEPDKLSTGS
ANRCEPKTGTPLLSYGMPTSPTVRIVDPDTCIECPAGTIGEIWVKGDNVAEGYWNKPDET
RHTFGAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIVYGRNHYPEDIESTV
QEITGGRVAAISVPVDHTEKLVTVIELKLLGDSAGEAMDELDVIKNNVTAAISRSHGLNV
ADLVLVPPGSIPTTTSGKIRRAACVEQYRLQQFTRLDG*

Genomic Sequence

>Rv1185c
ATGTCCGACTCTTCTGTCTTGTCCTTGCTGCGCGAGCGTGCCGGCCTGCAGCCCGACGAC
GCCGCGTTCACGTACATCGACTACGAACAGGATTGGGCCGGCATCACCGAAACGCTCACG
TGGTCAGAGGTGTTTCGACGGACCCGCATCGTTGCTCACGAAGTCAGGCGGCATTGCACG
ACCGGAGACCGAGCCGTGATTCTGGCTCCGCAGGGCCTGGCCTACATCGCGGCTTTCCTA
GGTTCGATGCAGGCCGGAGCGATAGCGGTTCCGTTGTCAGTCCCGCAGATCGGCTCTCAC
GACGAACGTGTCAGCGCGGTGCTTGCCGACGCGTCACCTTCGGTCATCCTGACAACATCT
GCGGTCGCAGAAGCGGTTGCCGAGCACATCCACCGGCCGAACACGAACAACGTAGGGCCG
ATCATCGAAATCGATTCATTGGACTTGACCGGGAATTCACCGAGCTTTCGGGTGAAGGAT
CTGCCAAGCGCCGCGTACTTGCAGTACACCTCTGGCTCCACCCGCGCTCCGGCTGGGGTC
ATGATCTCGCATCGGAACCTTCAGGCGAATTTCCAACAGCTGATGTCGAACTACTTCGGC
GACCGCAACGGTGTGGCGCCACCTGACACTACCATCGTGTCGTGGCTGCCGTTCTACCAC
GACATGGGCTTGGTCCTTGGCATCATCGCACCGATCCTGGGCGGCTACCGCAGTGAACTC
ACTAGCCCGCTGGCGTTCCTGCAACGGCCAGCGCGTTGGCTACATTCGCTGGCCAACGGA
AGTCCTTCGTGGTCGGCCGCACCGAATTTCGCCTTCGAATTGGCCGTCCGCAAGACAACA
GATGCCGACATAGAAGGCCTCGACCTCGGCAACGTCCTGGGCATCACCAGTGGTGCTGAA
CGAGTCCACCCCAACACGCTCAGTAGATTCTGCAACCGGTTTGCACCGTACAATTTCCGC
GAAGACATGATACGGCCTTCGTACGGTCTGGCGGAAGCGACTCTTTATGTGGCCAGCCGC
AATTCGGGTGACAAGCCAGAAGTCGTCTACTTCGAACCTGACAAGCTGTCCACGGGCAGT
GCGAATCGATGTGAACCCAAGACCGGCACACCGCTGCTGAGCTATGGCATGCCGACATCA
CCAACAGTGCGAATTGTGGATCCCGACACCTGCATTGAGTGCCCCGCGGGAACGATCGGC
GAGATCTGGGTGAAGGGCGACAACGTCGCCGAAGGCTACTGGAACAAACCGGACGAGACA
CGGCACACCTTTGGCGCAATGCTGGTCCACCCCTCGGCAGGTACTCCTGATGGATCCTGG
TTGCGAACGGGAGACCTCGGATTCCTCTCCGAGGACGAGATGTTCATCGTGGGCCGTATG
AAGGACATGCTGATCGTATACGGGCGCAATCACTACCCCGAGGACATCGAGTCGACCGTC
CAGGAGATCACTGGTGGTCGGGTCGCTGCGATTTCAGTTCCGGTCGATCACACAGAGAAG
TTAGTCACTGTCATCGAGCTCAAGCTCCTCGGCGATTCCGCCGGCGAAGCGATGGACGAA
CTCGATGTCATCAAGAACAACGTCACAGCCGCGATATCACGCTCGCACGGTCTCAACGTG
GCGGACCTCGTCTTGGTCCCGCCCGGGTCGATCCCCACCACAACCAGCGGCAAGATCAGA
AGGGCCGCCTGTGTAGAGCAATACCGGCTGCAGCAATTCACCCGGTTGGACGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007