Rv1265 - hypothetical protein

Expression: Most Significant Conditions for Rv1265

Protein Domains

Gene Information
Locus	Rv1265
Symbol
Gene Name	hypothetical protein
Location	1413260 - 1413940 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:681 bp Protein:227 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3636
Related Genes	MAP2506c MAV_1416 Mkms_4017 Mmcs_3943 MSMEG_5010 MT1303 MUL_4469 Mvan_4443 nfa54980 SAV7485
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1265
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1265 Transcript 1
MVLARPDAVFAPARNRCHVSLPVNAMSLKMKVCNHVIMRHHHMHGRRYGRPGGWQQAQQP
DASGAAEWFAGRLPEDWFDGDPTVIVDREEITVIGKLPGLESPEEESAARASGRVSRFRD
ETRPERMTIADEAQNRYGRKVSWGVEVGGERILFTHIAVPVMTRLKQPERQVLDTLVDAG
VARSRSDALAWSVKLVGEHTEEWLAKLRTAMSAVDDLRAQGPDLPA*

Genomic Sequence

>Rv1265
ATGGTTCTCGCCAGGCCGGACGCTGTTTTCGCGCCGGCCAGGAACCGGTGTCACGTTTCG
CTGCCGGTGAACGCGATGTCATTAAAGATGAAAGTATGTAATCATGTAATTATGAGGCAC
CATCACATGCACGGGCGGCGCTACGGTCGCCCCGGCGGCTGGCAGCAAGCTCAGCAACCA
GATGCCAGTGGGGCGGCGGAATGGTTCGCTGGCCGCCTGCCCGAGGACTGGTTCGACGGC
GACCCCACCGTCATCGTCGACCGTGAAGAAATTACGGTGATTGGCAAGCTGCCTGGACTC
GAGAGCCCCGAGGAAGAAAGTGCGGCCCGAGCCTCGGGCCGCGTGTCGCGATTCCGCGAC
GAAACCCGACCGGAGCGAATGACTATCGCCGATGAAGCCCAGAATCGCTACGGACGCAAG
GTGTCCTGGGGCGTCGAGGTCGGTGGTGAGCGAATCTTGTTCACGCACATCGCAGTACCG
GTGATGACGCGGTTAAAGCAGCCGGAACGGCAGGTGCTGGACACCTTGGTCGACGCTGGC
GTGGCTCGTTCCCGCTCGGATGCCCTCGCGTGGTCGGTCAAGCTGGTCGGCGAGCACACC
GAGGAGTGGCTGGCCAAGCTGCGCACCGCCATGTCGGCGGTGGACGATCTGCGCGCGCAA
GGCCCGGATCTTCCGGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1675c	active	jgalag	2012-10-05
	Band shift MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	RegulatedBy Rv1675c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	RegulatedBy Rv1675c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	RegulatedBy Rv1675c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	RegulatedBy Rv1675c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008