Rv1267c - transcriptional regulator embR

Expression: Most Significant Conditions for Rv1267c

Protein Domains

Gene Information
Locus	Rv1267c
Symbol	embR
Gene Name	transcriptional regulator embR
Location	1416181 - 1417347 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1167 bp Protein:389 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22612
Related Genes	MAP2503 MAV_1418 MT1305 MUL_4018
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1267c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1267c Transcript 1
MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALW
EEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKT
AGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEA
EIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLG
IDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRG
YPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSA
VTLNDGDHIRICDHEFTFQISAGTHGGT*

Genomic Sequence

>Rv1267c
ATGGCTGGTAGCGCGACAGTGGAGAAGCGGCTCGACTTCGGCCTGCTTGGACCATTGCAG
ATGACTATCGACGGCACCCCGGTGCCATCGGGCACCCCCAAGCAACGGGCTGTGCTAGCC
ATGTTGGTCATCAACCGCAACAGGCCCGTAGGAGTCGACGCCCTAATCACCGCCCTCTGG
GAGGAGTGGCCACCCTCGGGCGCACGCGCGAGTATCCACTCCTACGTGTCTAATCTGCGT
AAGCTCCTCGGTGGCGCCGGGATCGACCCACGGGTGGTGTTGGCCGCAGCGCCGCCGGGT
TATCGGCTCAGCATCCCCGACAACACTTGCGATCTGGGGCGGTTTGTTGCCGAAAAAACC
GCGGGCGTGCACGCGGCCGCCGCCGGCCGGTTCGAACAAGCCAGCCGCCACCTGTCGGCC
GCATTGAGAGAATGGCGTGGGCCGGTGCTCGATGACCTGCGCGACTTCCAGTTCGTCGAA
CCCTTTGCCACGGCGCTGGTAGAAGACAAGGTTCTTGCCCATACCGCCAAGGCGGAGGCC
GAAATCGCGTGTGGGCGGGCCAGCGCAGTGATCGCCGAGCTCGAGGCTCTGACATTCGAA
CACCCCTACCGGGAGCCGCTGTGGACACAGCTGATCACCGCCTACTACCTCTCCGACCGG
CAATCCGATGCGCTGGGCGCCTATCGCCGGGTGAAGACAACACTGGCCGACGACCTCGGC
ATCGACCCCGGTCCGACGTTGCGCGCTCTCAACGAGCGGATTCTGCGTCAGCAACCGCTG
GATGCCAAGAAGTCCGCCAAAACCACCGCTGCCGGCACCGTCACGGTGCTCGATCAGCGC
ACCATGGCGTCGGGCCAGCAGGCGGTGGCCTACCTGCACGACATCGCCTCGGGTCGCGGC
TACCCACTGCAAGCCGCGGCGACCCGGATCGGGCGTCTGCATGACAACGACATCGTCCTA
GACAGCGCCAACGTCAGCCGCCACCACGCCGTCATCGTCGACACGGGCACCAACTACGTC
ATCAACGACCTCCGATCGTCCAACGGCGTGCATGTGCAGCACGAGCGAATCCGCTCCGCG
GTCACGCTGAACGACGGCGACCACATTCGCATCTGTGACCATGAATTCACGTTCCAGATC
AGCGCGGGGACGCATGGCGGCACGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3795	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3795	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3795	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3795	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3795	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3795	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3794	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3794	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3794	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3794	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3794	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3794	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3793	active	priyadarshinipriyanka2001	2012-10-05
	Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv3795	active	priyadarshinipriyanka2001	2012-10-05
	Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv3794	active	priyadarshinipriyanka2001	2012-10-05
	Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Signaling Rv1266c	active	shruti4rana	2012-10-05
	Structural Analysis K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Signaling Rv1266c	active	shruti4rana	2012-10-05
	Structural Analysis LJ. Alderwick, V. Molle et al. Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Activation Rv1266c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3795	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3795	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3794	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3794	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3793	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3793	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1266c	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulates Rv3795	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3794	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3793	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1266c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Name	Transcriptional regulator of the embCAB operon	active	mjackson	2012-10-05
	PIM, LM and LAM biosynthesis
Name	Transcriptional regulator of the embCAB operon	active	mjackson	2012-10-05
	Arabinosyltransferases
Other	TBPWY:PIM, LM and LAM biosynthesis	active	mjackson	2012-03-05
	Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains]) AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
Other	TBPWY:PIM, LM and LAM biosynthesis	active	mjackson	2012-03-05
	Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains]) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006