Rv1280c - periplasmic oligopeptide-binding lipoprotein oppA

Expression: Most Significant Conditions for Rv1280c

Protein Domains

Gene Information
Locus	Rv1280c
Symbol	oppA
Gene Name	periplasmic oligopeptide-binding lipoprotein oppA
Location	1431665 - 1433440 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1776 bp Protein:592 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33891
Related Genes	Acel_1116 CE2224 cg2549 DIP1740 MAP2491 MAV_1429 Mkms_4005 ML1121 Mmcs_3931 MSMEG_4999 MT1317 MUL_4002 Mvan_4433 nfa1650 nfa1660 PPA1277 SAV3048 SAV874
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1280c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1280c Transcript 1
MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLE
LAPTADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKA
TLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIH
AISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA
TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR
LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLA
IAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGW
RRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN
VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARAL
ANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR*

Genomic Sequence

>Rv1280c
GTGGCTGACCGTGGCCAGCGACGAGGCTGCGCCCCGGGCATCGCGTCTGCGCTCAGGGCG
TCGTTTCAGGGGAAATCCAGACCCTGGACGCAGACTCGATATTGGGCTTTCGCGTTATTA
ACACCGCTCGTCGTGGCTATGGTGCTCACCGGATGCTCGGCCTCCGGTACCCAACTCGAA
CTCGCGCCCACTGCGGACCGCAGGGCCGCGGTTGGCACCACCAGCGACATCAATCAGCAG
GATCCCGCCACGTTGCAAGACGGCGGCAATCTTCGCCTGTCGCTCACCGACTTTCCGCCC
AACTTCAACATCTTGCACATCGACGGCAACAACGCCGAGGTCGCGGCGATGATGAAAGCC
ACCTTGCCGCGCGCGTTCATCATCGGACCGGACGGCTCGACGACGGTCGACACCAACTAC
TTCACCAGCATCGAGCTGACCAGGACCGCCCCGCAGGTGGTCACCTACACCATCAATCCC
GAGGCGGTGTGGTCCGACGGGACCCCGATCACCTGGCGGGACATCGCCAGCCAGATTCAT
GCGATCAGCGGCGCCGACAAGGCATTCGAGATCGCTTCTAGCAGCGGCGCCGAGCGTGTG
GCGTCGGTAACCAGAGGGGTCGACGACCGGCAGGCCGTGGTGACGTTCGCCAAGCCGTAC
GCGGAGTGGCGCGGTATGTTCGCGGGCAACGGCATGCTGCTGCCGGCCAGTATGACCGCC
ACACCCGAGGCATTCAATAAGGGTCAACTCGATGGGCCCGGTCCGTCGGCGGGTCCGTTC
GTCGTGTCTGCCCTGGACCGCACCGCGCAGCGAATCGTGTTGACCCGTAACCCGAGATGG
TGGGGGGCACGGCCACGCCTGGACAGCATCACATACCTGGTGCTCGATGATGCCGCCCGG
CTGCCGGCGCTGCAGAACAACACAATCGACGCCACCGGCGTCGGCACACTGGACCAGCTG
ACCATCGCGGCGCGCACCAAGGGCATCTCGATCCGGCGCGCCCCCGGGCCCAGCTGGTAT
CACTTCACCCTCAACGGTGCGCCTGGGTCGATCCTCGCCGACAAGGCGCTGCGCCTGGCG
ATCGCCAAGGGCATCGACCGATACACCATCGCCAGGGTCGCCCAATACGGCCTCACCAGC
GACCCGGTGCCACTGAACAACCACGTCTTCGTCGCCGGCCAAGACGGCTACCAGGACAAC
AGCGGCGTTGTCGCCTACAACCCGGAACAAGCGAAACGGGAGCTGGACGCCCTGGGCTGG
AGGCGAAGCGGCGCGTTCCGGGAGAAGGACGGTCGCCAGCTCGTCATCCGCGATCTGTTC
TACGACGCACAAAGCACCCGGCAGTTCGCCCAGATCGCCCAACACACCCTGGCGCAGATC
GGCGTCAAACTCGAACTTCAGGCCAAGTCCGGCAGCGGTTTCTTCAGCGACTACGTCAAC
GTGGGGGCTTTCGACATCGCACAGTTCGGCTGGGTGGGCGACGCGTTTCCGCTGTCATCG
CTCACCCAGATCTACGCTTCGGACGGGGAAAGCAACTTCGGCAAGATCGGTAGCCCGCAA
ATCGACGCCGCGATCGAGCGAACGCTGGCAGAACTCGATCCCGGCAAGGCGAGGGCCTTG
GCCAACCAGGTCGACGAGCTGATCTGGGCCGAAGGATTCAGCCTGCCGCTTACCCAGTCG
CCCGGCACCGTTGCGGTCCGCAGCACGCTGGCCAACTTCGGCGCGACGGGTCTGGCAGAC
CTGGACTACACCGCCATCGGGTTCATGCGACGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007